Property Summary

NCBI Gene PubMed Count 20
PubMed Score 37.02
PubTator Score 29.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -4.688 8.9e-09
psoriasis -2.100 4.5e-20

Gene RIF (11)

AA Sequence

MALLPVLFLVTVLLPSLPAEGKDPAFTALLTTQLQVQREIVNKHNELRKAVSPPASNMLKMEWSREVTTN      1 - 70
AQRWANKCTLQHSDPEDRKTSTRCGENLYMSSDPTSWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQL     71 - 140
VWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCPDDCDKGLCTNSCQYQDL    141 - 210
LSNCDSLKNTAGCEHELLKEKCKATCLCENKIY                                         211 - 243
//

Text Mined References (20)

PMID Year Title