Property Summary

NCBI Gene PubMed Count 18
Grant Count 503
R01 Count 319
Funding $50,442,761.76
PubMed Score 35.24
PubTator Score 29.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -4.688 0.000
psoriasis -2.100 0.000

Synonym

Accession P16562 A8K8M0 Q53FF2 Q5U8Z9 Q7Z7B2 CRISP-2
Symbols CT36
TPX1
TSP1
GAPDL5
CRISP-2

Gene

PANTHER Protein Class (1)

PDB

2CQ7  

Gene RIF (9)

PMID Text
25505194 Preliminary insight into the mechanism leading to the reduced CRISP2 expression in asthenozoospermia, offering a potential therapeutic target for treating male infertility or for male contraception.
23661501 Study shows the re-association of sperm acrosomal CRISP2 at the EqS during the acrosome reaction. Data showed that F-actin is not involved in the relocalization of CRISP2. Found that basic,but not acidic, conditions can solubilize CRISP2 from sperm cells.
23027975 CRISP2 rescues the phenotype of yeast mutants lacking Pry function and purified CRISP2 binds cholesterol in vitro, indicating that lipid binding is a conserved function of the CAP superfamily proteins.
21485539 The down-regulation of CRISP2 mRNA and protein expressions in the sperm of asthenospermia patients may be closely related with decreased sperm motility.
20625511 Additional transcription changes likely associated with Th2-like eosinophilic inflammation were prominent and included decreased CRISP2&3.
18550510 Polymorphisms within the CRISP2 gene have no significant association with male infertility.
18550510 Observational study of gene-disease association. (HuGE Navigator)
16759931 The protein level and localization of TPX1 were altered in patients with spermatogenic arrest and in infertile men with oligoasthenoteratospermia syndrome.
15734896 TPX1 is a component of the sperm acrosome that remains associated with sperm after capacitation and acrosome reaction , and is relevant for sperm-oocyte interaction.

AA Sequence

MALLPVLFLVTVLLPSLPAEGKDPAFTALLTTQLQVQREIVNKHNELRKAVSPPASNMLKMEWSREVTTN      1 - 70
AQRWANKCTLQHSDPEDRKTSTRCGENLYMSSDPTSWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQL     71 - 140
VWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCPDDCDKGLCTNSCQYQDL    141 - 210
LSNCDSLKNTAGCEHELLKEKCKATCLCENKIY                                         211 - 243
//

Publication (18)

PMID Year Title
25505194 2015 The expression of cysteine-rich secretory protein 2 (CRISP2) and its specific regulator miR-27b in the spermatozoa of patients with asthenozoospermia.
23661501 2013 Human sperm CRISP2 is released from the acrosome during the acrosome reaction and re-associates at the equatorial segment.
23027975 2012 Pathogen-Related Yeast (PRY) proteins and members of the CAP superfamily are secreted sterol-binding proteins.
21485539 2011 [Expressions of cysteine-rich secretory protein 2 in asthenospermia].
20625511 2010 Gene transcription changes in asthmatic chronic rhinosinusitis with nasal polyps and comparison to those in atopic dermatitis.
18550510 2008 Polymorphisms in the human cysteine-rich secretory protein 2 (CRISP2) gene in Australian men.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16759931 2006 Human testis specific protein 1 expression in human spermatogenesis and involvement in the pathogenesis of male infertility.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15734896 2005 Human testicular protein TPX1/CRISP-2: localization in spermatozoa, fate after capacitation and relevance for gamete interaction.
More...