Property Summary

NCBI Gene PubMed Count 373
Grant Count 19
R01 Count 7
Funding $1,112,784.45
PubMed Score 231.54
PubTator Score 500.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.500 0.010
group 3 medulloblastoma 1.900 0.005
pituitary cancer 2.500 0.000

Gene RIF (446)

PMID Text
26925743 no significant difference in the distribution of genotypes between vasovagal syncope patients and control group
26915373 GNB3 TT genotype was associated with lower left ventricular ejection fraction at 6 and 12 months in women with peripartum cardiomyopathy.
26551933 TT genotype of GNbeta3 C825T is more common among patients with functional dyspepsia than among healthy controls.
26177133 our study showed association of C825T polymorphism of the GNB3 with obesity, but did not prove the association this with the degree of obesity i patients with AH.
26147511 The T-allele of GNbeta3 C825Tcan increase susceptibility to depression. After stratification by ethnicity, the same association was found in the Asian subpopulation, but not the Caucasian subpopulation.
25903425 The present review illustrates that the C825T polymorphism is associated with increased cardiovascular risk of death and disease in Caucasian patients, independently of other established cardiovascular risk factors.
25659220 No statistically significant differences in GNb3 allele frequencies were observed between oesophageal adenocarcinoma cases and controls
25463071 GNB3 825 TT genotype is a significant and independent risk factor for hard coronary events independent of other established cardiovascular risk factors at a population level in male
25451402 GNB3 C825T polymorphisms may be correlated with the efficacy of antidepressants in the treatment of MDD, especially among Asians patients.
25306451 Results show The GNB3 TT genotype was associated with greater therapeutic effect.
More...

AA Sequence

MGEMEQLRQEAEQLKKQIADARKACADVTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLL      1 - 70
VSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELS     71 - 140
AHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKL    141 - 210
WDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESIICGITSVAFSL    211 - 280
SGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN              281 - 340
//

Text Mined References (373)

PMID Year Title
26925743 2016 Beta 3 subunit of G-protein and its influence on autonomic nervous system in patients with vasovagal syncope.
26915373 2016 GNB3 C825T Polymorphism and Myocardial Recovery in Peripartum Cardiomyopathy: Results of the Multicenter Investigations of Pregnancy-Associated Cardiomyopathy Study.
26551933 2016 Functional dyspepsia is associated with GN?3 C825T and CCK-AR T/C polymorphism.
26177133 [DISTRIBUTION OF GENOTYPES OF C825T POLYMORPHISM ?3-SUBUNIT G-PROTEIN GENE IN PATIENTS WITH ARTERIAL HYPERTENSION ACCORDING THE DEGREE OF OBESITY].
26147511 2015 The C825T Polymorphism of the G-Protein ?3 Gene as a Risk Factor for Depression: A Meta-Analysis.
25903425 2015 G-Protein ?3-Subunit Gene C825T Polymorphism and Cardiovascular Risk: An Updated Review.
25659220 2015 Letter: role of GN?3 polymorphisms in oesophageal adenocarcinoma and gastroesophageal reflux disease.
25463071 2014 GNB3 gene 825 TT variant predicts hard coronary events in the population-based Heinz Nixdorf Recall study.
25451402 2015 Influence of GNB3 C825T polymorphism on the efficacy of antidepressants in the treatment of major depressive disorder: A meta-analysis.
25306451 2014 G-protein beta-3 subunit genotype predicts enhanced benefit of fixed-dose isosorbide dinitrate and hydralazine: results of A-HeFT.
More...