Property Summary

NCBI Gene PubMed Count 58
Grant Count 36
R01 Count 23
Funding $2,087,237.91
PubMed Score 107.02
PubTator Score 125.92

Knowledge Summary

Patent

No data available

Expression

Gene RIF (22)

PMID Text
26607656 PCSK2 gene polymorphisms are associated with pleiotropic effects on various traits of glucose homeostasis and incident diabetes.
25811241 FAM20C plays a role in 7B2-mediated proPC2 activation by phosphorylating residue Thr111; and that 7B2 function is regulated by alternative splicing.
24226266 in the processing of hypothalamic neuropeptides in huntington disease may partially arise from decreased PC1/3 and PC2 expressions.
23011353 variant of the PCSK2 gene was associated with reduced glucose-stimulated insulin secretion, but also with lower glucagon levels, which could potentially counteract the effects of decreased insulin secretion on the risk of type 2 diabetes
21437630 The association of risk allele rs2021785 at PCSK2 with type 2 diabetes exists in a Han Chinese population
21383526 differential gene expression profiles revealed more abundant mRNA expression in ectopic ACTH syndrome than in Cushing disease of proprotein convertase-2
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
20036365 SEMA3F, CLEC16A, LAMA3, and PCSK2 variants have roles in myocardial infarction in Japanese individuals
19851296 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKGGCVSQWKAAAGFLFCVMVFASAERPVFTNHFLVELHKGGEDKARQVAAEHGFGVRKLPFAEGLYHFY      1 - 70
HNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLINTGQADG     71 - 140
TPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGT    141 - 210
RCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDG    211 - 280
PRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSST    281 - 350
LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN    351 - 420
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLT    421 - 490
TDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTW    491 - 560
GEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYIDQVVRDYQSKLAMSKKEELEEELDEAVERS    561 - 630
LKSILNKN                                                                  631 - 638
//

Text Mined References (60)

PMID Year Title
26607656 2015 Genetic polymorphisms of PCSK2 are associated with glucose homeostasis and progression to type 2 diabetes in a Chinese population.
25811241 2015 Phosphorylation and Alternative Splicing of 7B2 Reduce Prohormone Convertase 2 Activation.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24839885 2014 A genome-wide association meta-analysis of preschool internalizing problems.
24226266 2013 Decreased hypothalamic prohormone convertase expression in huntington disease patients.
23775089 2013 The multifaceted proprotein convertases: their unique, redundant, complementary, and opposite functions.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23011353 2012 Effect of a common variant of the PCSK2 gene on reduced insulin secretion.
22679642 2012 The biology and therapeutic targeting of the proprotein convertases.
21805237 2011 The proprotein convertases, 20 years later.
More...