Property Summary

NCBI Gene PubMed Count 312
Grant Count 173
R01 Count 129
Funding $26,376,871.76
PubMed Score 1127.23
PubTator Score 1666.74

Knowledge Summary

Patent (51,709)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.600 0.043
psoriasis -2.200 0.000
osteosarcoma -2.058 0.015
ependymoma 1.300 0.032
colon cancer -1.400 0.010
group 4 medulloblastoma 1.200 0.004
facioscapulohumeral dystrophy -2.000 0.042

Synonym

Accession P16473 A0PJU7 F5GYU5 G3V2A9 Q16503 Q8TB90 Q96GT6 Q9P1V4 Q9ULA3 Q9UPH3
Symbols LGR3
CHNG1
hTSHR-I

Gene

PANTHER Protein Class (1)

PDB

1XUM   2XWT   3G04  

  TechDev Info (1)

MLP Assay (19)

AID Type Active / Inconclusive / Inactive Description
926 confirmatory 352 / 12374 / 57004 qHTS Assay for Agonists of the Thyroid Stimulating Hormone Receptor
933 confirmatory 42 / 58 / 267 Secondary Concentration-Response Assay for Agonists of the Thyroid Stimulating Hormone Receptor: HTRF Activity Detection
938 confirmatory 1807 / 9716 / 61633 qHTS Assay for Agonists of the Thyroid Stimulating Hormone Receptor: Activators of Intracellular cAMP Concentrations in Parental HEK 293
939 confirmatory 35 / 51 / 65 Confirmation Concentration-Response Assay for Agonists of the Thyroid Stimulating Hormone Receptor
953 confirmatory 0 / 6 / 145 Confirmation Concentration-Response Assay for Agonists of the Thyroid Stimulating Hormone Receptor: Activators of Intracellular cAMP Concentrations in Parental HEK 293
1401 summary 33 / 29 / 64 Quantitative High-Throughput Screen for Agonists of Thyroid Stimulating Hormone Receptor: Summary
2104 confirmatory 13 / 11 / 9 Secondary Concentration-Response Assay for Agonists of the Thyroid Stimulating Hormone Receptor: ELISA Activity Detection
488980 confirmatory 0 / 5 / 1275 qHTS Assay for Antagonists of the Thyroid Stimulating Hormone Receptor
488990 summary 0 / 0 / 0 qHTS Assay for Inverse Agonists of the Thyroid Stimulating Hormone Receptor: Summary
504379 confirmatory 5 / 0 / 7 Concentration-response assay for inverse agonists of the thyroid stimulating hormone receptor: ELISA activity detection
More...

Gene RIF (241)

PMID Text
26545118 data support a structural model of the TSHR transmembrane domain with a bulged transmembrane helix TM2 and a straight TM5 that is specific of glycoprotein hormone receptors
26519197 The eminent ratio of TSHr methylation in well-differentiated thyroid carcinoma against benign thyroidal nodules adduced that TSHr methylation status can be utilized as a tumor marker for well-differentiated thyroid cancer.
26356361 TSHR gene polymorphisms are associated with typical symptoms in primary congenital hypothyroidism.
26212344 Patients with preoperative TSHR-mRNA >/=1.02 ng/mug may be at a greater risk for recurrence of thyroid cancer.
25978107 TSHR mutations are common among Hungarian patients with Congenital hypothyroidism. The novel genetic alterations revealed an important structural role of the N432(1.50) and the P449(2.39) residues in receptor expression and signaling, respectively.
25557138 subclinical hypothyroidism in heterozygotes with TSHR mutations is a stable compensated condition with an appropriately adjusted set point for pituitary-thyroid feedback that does not require replacement therapy
25543543 Thyroid-stimulating hormone receptor intronic polymorphisms are associated with the susceptibility to Graves' disease and Graves' ophthalmopathy in the Brazilian population, but do not appear to influence the disease course.
25340405 the hinge region and its adjacent domains have roles in binding and signaling patterns of the thyrotropin and follitropin receptor
25303483 Our data suggest a role for PTCSC2, FOXE1, and TSHR in the predisposition to papillary thyroid carcinoma.
25153578 TSHR gene variants are associated with congenital hypothyroidism.
More...

AA Sequence

MRPADLLQLVLLLDLPRDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSH      1 - 70
AFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPDALKELPLLKFLGIFNTGLKM     71 - 140
FPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETLTLKLYNNGFTSVQGYAFNGTKLDAVYLNKN    141 - 210
KYLTVIDKDAFGGVYSGPSLLDVSQTSVTALPSKGLEHLKELIARNTWTLKKLPLSLSFLHLTRADLSYP    211 - 280
SHCCAFKNQKKIRGILESLMCNESSMQSLRQRKSVNALNSPLHQEYEENLGDSIVGYKEKSKFQDTHNNA    281 - 350
HYYVFFEEQEDEIIGFGQELKNPQEETLQAFDSHYDYTICGDSEDMVCTPKSDEFNPCEDIMGYKFLRIV    351 - 420
VWFVSLLALLGNVFVLLILLTSHYKLNVPRFLMCNLAFADFCMGMYLLLIASVDLYTHSEYYNHAIDWQT    421 - 490
GPGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHACAIMVGGWVCCFLLALLPLVGI    491 - 560
SSYAKVSICLPMDTETPLALAYIVFVLTLNIVAFVIVCCCYVKIYITVRNPQYNPGDKDTKIAKRMAVLI    561 - 630
FTDFICMAPISFYALSAILNKPLITVSNSKILLVLFYPLNSCANPFLYAIFTKAFQRDVFILLSKFGICK    631 - 700
RQAQAYRGQRVPPKNSTDIQVQKVTHDMRQGLHNMEDVYELIENSHLTPKKQGQISEEYMQTVL          701 - 764
//

Text Mined References (316)

PMID Year Title
26545118 2015 Molecular Insights into the Transmembrane Domain of the Thyrotropin Receptor.
26519197 2015 Methylation status of TSHr in well-differentiated thyroid cancer by using cytologic material.
26356361 2016 Evaluation of the tshr gene reveals polymorphisms associated with typical symptoms in primary congenital hypothyroidism.
26212344 2015 The utility of peripheral thyrotropin receptor mRNA in the management of differentiated thyroid cancer.
25978107 2015 Loss-of-Function Variants in a Hungarian Cohort Reveal Structural Insights on TSH Receptor Maturation and Signaling.
25729143 2015 Genome-wide association study identifies three novel genetic markers associated with elite endurance performance.
25557138 2015 Long-term outcome of loss-of-function mutations in thyrotropin receptor gene.
25543543 2015 TSHR intronic polymorphisms (rs179247 and rs12885526) and their role in the susceptibility of the Brazilian population to Graves' disease and Graves' ophthalmopathy.
25340405 2014 Influence of the hinge region and its adjacent domains on binding and signaling patterns of the thyrotropin and follitropin receptor.
25303483 2015 Genetic predisposition to papillary thyroid carcinoma: involvement of FOXE1, TSHR, and a novel lincRNA gene, PTCSC2.
More...