Property Summary

NCBI Gene PubMed Count 141
Grant Count 232
R01 Count 149
Funding $18,628,865.39
PubMed Score 603.84
PubTator Score 452.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.142 0.023
sonic hedgehog group medulloblastoma 3.000 0.000
pancreatic cancer -1.300 0.001
breast carcinoma 1.400 0.000
fibroadenoma 1.300 0.013
adult high grade glioma 1.200 0.002
psoriasis -1.500 0.000
nasopharyngeal carcinoma 1.500 0.012
ductal carcinoma in situ 2.600 0.000
invasive ductal carcinoma 2.800 0.002
ulcerative colitis -1.600 0.000
pituitary cancer -3.100 0.000

Synonym

Accession P16471 B2R882 D1MDP1 Q16354 Q8TD75 Q8TD78 Q96P35 Q96P36 Q9BX87 Q9UHJ5 PRL-R
Symbols HPRL
MFAB
hPRLrI

Gene

PDB

1BP3   2LFG   2N7I   3D48   3MZG   3N06   3N0P   3NCB   3NCC   3NCE   3NCF   4I18  

Gene RIF (109)

PMID Text
26844452 The prolactin receptor is constitutively expressed on regulatory T and effector T cells in systemic lupus erythematosus patients, and this expression is higher than in healthy individuals.
26586670 PRL-PRLR can escalate the impact of breast cancer on bone metastasis and the presence of PRLR in the tumor microenvironment of breast cancer bone metastasis has the potential to modulate the microenvironment to induce lytic osteoclast formation.
26513615 Two markers for the PRL peptide gene and three markers for the prolactin receptor (PRLR) gene were genotyped.
26095602 long PRLR plays an important role in breast cancer metastasis.
25846210 Data suggest that (1) cell membrane/lipid bilayer binding of PRLR and (2) tyrosine phosphorylation of PRLR intracellular domain are independent.
25784554 a residue quartet in the extracellular membrane proximal domain of the homodimeric cytokine receptor prolactin receptor is a key regulator of intracellular signaling discrimination
25524456 Study shows that position 146 plays a central role in directing intrinsic properties of the PRLR, including extracellular domain folding, PRL-responsiveness, and ligand-independent activity of the receptor.
24997655 exposure to prolactin increases TNF-alpha release from CD14(+) monocytes of rheumatoid arthritis patients, which can be abolished by PRLR gene silencing or treating with MAPK inhibitor.
24990775 There is a possible role for PRLR in the progression of cervical cancer.
24758841 PRL induced transient signaling pathways in neurons and modulated ion channels. [review]
More...

AA Sequence

MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGET      1 - 70
LMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQP     71 - 140
EDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKP    141 - 210
DHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFD    211 - 280
AHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSG    281 - 350
RGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQ    351 - 420
PSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDT    421 - 490
PWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVL    491 - 560
VPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH            561 - 622
//

Text Mined References (144)

PMID Year Title
26844452 2016 Function of Treg Cells Decreased in Patients With Systemic Lupus Erythematosus Due To the Effect of Prolactin.
26586670 2016 The Role of Prolactin in Bone Metastasis and Breast Cancer Cell-Mediated Osteoclast Differentiation.
26513615 2016 Possible association between the prolactin receptor gene and callous-unemotional traits among aggressive children.
26095602 2015 Anti-metastatic outcome of isoform-specific prolactin receptor targeting in breast cancer.
25846210 2015 Intrinsically disordered cytoplasmic domains of two cytokine receptors mediate conserved interactions with membranes.
25784554 2015 A Residue Quartet in the Extracellular Domain of the Prolactin Receptor Selectively Controls Mitogen-activated Protein Kinase Signaling.
25524456 2015 Residue 146 regulates prolactin receptor folding, basal activity and ligand-responsiveness: potential implications in breast tumorigenesis.
25358647 2015 Comparative genomics reveals tissue-specific regulation of prolactin receptor gene expression.
24997655 2014 Prolactin increases tumor necrosis factor alpha expression in peripheral CD14 monocytes of patients with rheumatoid arthritis.
24990775 2015 Prolactin and prolactin receptor expression in cervical intraepithelial neoplasia and cancer.
More...