Property Summary

NCBI Gene PubMed Count 144
PubMed Score 616.63
PubTator Score 452.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.200 1.7e-03
breast carcinoma 1.300 1.4e-04
ductal carcinoma in situ 1.600 1.8e-05
fibroadenoma 1.300 1.3e-02
invasive ductal carcinoma 2.200 3.1e-03
medulloblastoma 1.600 2.5e-02
nasopharyngeal carcinoma 1.500 1.2e-02
osteosarcoma -1.142 2.3e-02
pancreatic cancer -1.300 1.2e-03
pituitary cancer -1.100 2.0e-05
psoriasis -1.200 4.0e-29
ulcerative colitis -1.600 3.3e-05

Protein-protein Interaction (1)

Gene RIF (112)

AA Sequence

MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGET      1 - 70
LMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQP     71 - 140
EDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKP    141 - 210
DHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFD    211 - 280
AHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSG    281 - 350
RGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQ    351 - 420
PSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDT    421 - 490
PWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVL    491 - 560
VPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH            561 - 622
//

Text Mined References (147)

PMID Year Title