Property Summary

NCBI Gene PubMed Count 37
PubMed Score 6.65
PubTator Score 124.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
ductal carcinoma in situ -1.700 4.8e-03
invasive ductal carcinoma -1.700 2.6e-02
mucosa-associated lymphoid tissue lympho... 2.387 2.1e-02
osteosarcoma -7.093 3.3e-06
ovarian cancer -1.900 2.3e-17

Gene RIF (8)

AA Sequence

MGQALGIKSCDFQAARNNEEHHTKALSSRRLFVRRGQPFTIILYFRAPVRAFLPALKKVALTAQTGEQPS      1 - 70
KINRTQATFPISSLGDRKWWSAVVEERDAQSWTISVTTPADAVIGHYSLLLQVSGRKQLLLGQFTLLFNP     71 - 140
WNREDAVFLKNEAQRMEYLLNQNGLIYLGTADCIQAESWDFGQFEGDVIDLSLRLLSKDKQVEKWSQPVH    141 - 210
VARVLGALLHFLKEQRVLPTPQTQATQEGALLNKRRGSVPILRQWLTGRGRPVYDGQAWVLAAVACTVLR    211 - 280
CLGIPARVVTTFASAQGTGGRLLIDEYYNEEGLQNGEGQRGRIWIFQTSTECWMTRPALPQGYDGWQILH    281 - 350
PSAPNGGGVLGSCDLVPVRAVKEGTLGLTPAVSDLFAAINASCVVWKCCEDGTLELTDSNTKYVGNNIST    351 - 420
KGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPPSLETASPLYLLLKAPSSLPLRGD    421 - 490
AQISVTLVNHSEQEKAVQLAIGVQAVHYNGVLAAKLWRKKLHLTLSANLEKIITIGLFFSNFERNPPENT    491 - 560
FLRLTAMATHSESNLSCFAQEDIAICRPHLAIKMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGL    561 - 630
IHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVTVVAPELSA             631 - 691
//

Text Mined References (41)

PMID Year Title