Property Summary

Ligand Count 20
NCBI Gene PubMed Count 34
PubMed Score 295.68
PubTator Score 173.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

 MGI Phenotype (1)

Gene RIF (10)

AA Sequence

MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPK      1 - 70
LRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGV     71 - 140
EGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLI    141 - 210
DLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANL    211 - 280
SQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVF    281 - 350
EAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLASLAPLVLCLSLL             351 - 411
//

Text Mined References (36)

PMID Year Title