Property Summary

NCBI Gene PubMed Count 33
Grant Count 19
R01 Count 2
Funding $2,943,595.9
PubMed Score 284.71
PubTator Score 173.32

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
26392408 In this study, we present an analysis of Neanderthal introgression at the dipeptidase 1 gene, DPEP1.
23839495 Dipeptidase 1 has been identified as an excellent marker of high-grade IEN and CRC, and may thus be applied for screening of early neoplastic lesions and for prognostic stratification.
22363658 DPEP1 plays a role in pancreatic cancer aggressiveness.
21076463 we identified a novel immunohistochemical marker, dipeptidase 1, to distinguish primary mucinous ovarian cancers from ovarian metastasis of colorectal cancers.
20824289 DPEP1 is expressed in the early stages of colon carcinogenesis and affects cancer cell invasiveness.
20031578 CPS1, MUT, NOX4, and DPEP1 is associated with plasma homocysteine in healthy Women.
20031578 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
15145522 DPEP1 has a role in colorectal carcinoma
12144777 Crystal structure of human renal dipeptidase involved in beta-lactam hydrolysis

AA Sequence

MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPK      1 - 70
LRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGV     71 - 140
EGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLI    141 - 210
DLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANL    211 - 280
SQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVF    281 - 350
EAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLASLAPLVLCLSLL             351 - 411
//

Text Mined References (35)

PMID Year Title
26392408 2015 Reintroduction of a Homocysteine Level-Associated Allele into East Asians by Neanderthal Introgression.
25416956 2014 A proteome-scale map of the human interactome network.
23839495 2013 Dipeptidase 1 (DPEP1) is a marker for the transition from low-grade to high-grade intraepithelial neoplasia and an adverse prognostic factor in colorectal cancer.
23824729 2013 Common genetic loci influencing plasma homocysteine concentrations and their effect on risk of coronary artery disease.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22363658 2012 DPEP1 inhibits tumor cell invasiveness, enhances chemosensitivity and predicts clinical outcome in pancreatic ductal adenocarcinoma.
21076463 2011 Distinguishing primary from secondary mucinous ovarian tumors: an algorithm using the novel marker DPEP1.
20824289 2011 DPEP1, expressed in the early stages of colon carcinogenesis, affects cancer cell invasiveness.
20435919 2010 Cilastatin attenuates cisplatin-induced proximal tubular cell damage.
More...