Property Summary

NCBI Gene PubMed Count 135
Grant Count 217
R01 Count 63
Funding $69,631,011.59
PubMed Score 103.66
PubTator Score 1006.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
psoriasis 2.600 0.000
astrocytoma 1.300 0.025
tuberculosis and treatment for 6 months -1.300 0.000
pancreatic ductal adenocarcinoma liver m... -2.101 0.016
ovarian cancer 1.200 0.001
pituitary cancer -1.500 0.000

Synonym

Accession P16435 Q16455 Q197M5 Q8N181 Q9H3M8 Q9UDT3 CPR
Symbols CPR
CYPOR
P450R

Gene

POR

PDB

1B1C   3FJO   3QE2   3QFC   3QFR   3QFS   3QFT   5EMN   5FA6  

Gene RIF (89)

PMID Text
26669712 P450 (Cytochrome) Oxidoreductase Gene (POR) Common Variant (POR*28) Significantly Alters CYP2C9 Activity in Swedish, But Not in Korean Healthy Subjects
26580670 the POR g.6593A>G polymorphism significantly influences CYP2B6 activity
26544874 POR besides CYP2B6 can influence cyclophosphamide metabolism
26297733 POR is the main determinant of SN30000 sensitivity in 3 different genetic backgrounds. Head and neck squamous cell carcinomas showed heterogeneous POR expression. There may be a relationship between HPV status and hypoxia-activated prodrug sensitivity.
26123203 POR A503V might decrease the risk of bladder cancer by reducing its metabolic activity.
26087061 electron transfer between mCPR and aromatase
26067485 This study confirmed that CYP3A5*1 was associated with lower tacrolimus trough concentrations. POR*28 was associated with decreased tacrolimus trough concentrations although the effect was small possibly through enhanced CYP3A4 enzyme activity.
25809265 Study is a thorough structural, dynamic, and thermodynamic characterization of the soluble form of human microsomal CPR using small-angle x-ray scattering and nuclear magnetic resonance spectroscopy under various conditions
25728647 Transient kinetic dissection of the reaction of POR with NADPH and the reduction in cytochrome c by POR using stopped-flow techniques revealed defects in individual electron transfer steps mediated by A287P.
25712184 We identified seven unreported SNP genetic variations. The p.Pro384Leu variant exhibited reduced enzymatic activities compared with wild-type.
More...

AA Sequence

MGDSHVDTSSTVSEAVAEEVSLFSMTDMILFSLIVGLLTYWFLFRKKKEEVPEFTKIQTLTSSVRESSFV      1 - 70
EKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDNALVVFCMATY     71 - 140
GEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRIFELGLGDDDG    141 - 210
NLEEDFITWREQFWPAVCEHFGVEATGEESSIRQYELVVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKN    211 - 280
PFLAAVTTNRKLNQGTERHLMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGKILGADLDVVMSLNN    281 - 350
LDEESNKKHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQELLRKMASSSGEGKELYLSWV    351 - 420
VEARRHILAILQDCPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVVVEYETKAGRINKGVA    421 - 490
TNWLRAKEPAGENGGRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAPFIGFIQERAWLRQQGKEVGET    491 - 560
LLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSREQSHKVYVQHLLKQDREHLWKLIEGGAHIYVCG    561 - 630
DARNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTKGRYSLDVWS                           631 - 677
//

Text Mined References (141)

PMID Year Title
26669712 2015 P450 (Cytochrome) Oxidoreductase Gene (POR) Common Variant (POR*28) Significantly Alters CYP2C9 Activity in Swedish, But Not in Korean Healthy Subjects.
26580670 2016 Effects of the selected cytochrome P450 oxidoreductase genetic polymorphisms on cytochrome P450 2B6 activity as measured by bupropion hydroxylation.
26544874 2015 Cytochrome P450 Oxidoreductase Influences CYP2B6 Activity in Cyclophosphamide Bioactivation.
26297733 2015 Identification of P450 Oxidoreductase as a Major Determinant of Sensitivity to Hypoxia-Activated Prodrugs.
26123203 2015 Functional POR A503V is associated with the risk of bladder cancer in a Chinese population.
26087061 2015 Analysis of the complex formation, interaction and electron transfer pathway between the "open" conformation of NADPH-cytochrome P450 reductase and aromatase.
26067485 2015 Multigene predictors of tacrolimus exposure in kidney transplant recipients.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25809265 2015 A well-balanced preexisting equilibrium governs electron flux efficiency of a multidomain diflavin reductase.
25728647 2015 Electron transfer by human wild-type and A287P mutant P450 oxidoreductase assessed by transient kinetics: functional basis of P450 oxidoreductase deficiency.
More...