Property Summary

NCBI Gene PubMed Count 252
PubMed Score 1618.56
PubTator Score 915.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cancer 2499 6.248 3.1
Liver disease 237 3.217 1.6

Expression

  Differential Expression (27)

Disease log2 FC p
glioblastoma -1.300 2.6e-03
ovarian cancer 2.600 1.7e-07
acute myeloid leukemia 2.700 2.5e-02
adult high grade glioma -1.200 6.1e-03
astrocytic glioma -2.300 1.9e-02
atypical teratoid/rhabdoid tumor 1.300 4.0e-02
Barrett's esophagus 3.400 3.3e-02
breast carcinoma 2.000 1.3e-02
ductal carcinoma in situ 4.300 2.3e-03
ependymoma -1.900 8.4e-13
esophageal adenocarcinoma 4.300 1.8e-02
group 3 medulloblastoma -1.400 2.1e-02
interstitial cystitis -2.900 2.0e-02
intraductal papillary-mucinous carcinoma... 1.200 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.200 3.8e-02
invasive ductal carcinoma 4.200 1.7e-02
lung adenocarcinoma 1.070 7.1e-05
lung cancer 2.300 2.2e-05
lung carcinoma 1.400 1.5e-13
malignant mesothelioma 2.000 2.8e-07
medulloblastoma, large-cell -1.400 3.0e-02
nasopharyngeal carcinoma 1.200 1.2e-02
nephrosclerosis -1.260 5.0e-02
oligodendroglioma -2.200 2.6e-02
pancreatic ductal adenocarcinoma liver m... 3.765 6.6e-03
periodontitis -1.100 1.5e-19
psoriasis -2.300 4.0e-10

 CSPA Cell Line (4)

Gene RIF (230)

AA Sequence

MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMK      1 - 70
AEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVR     71 - 140
TYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIA    141 - 210
DVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVV    211 - 280
AGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA                                        281 - 314
//

Text Mined References (254)

PMID Year Title