Property Summary

NCBI Gene PubMed Count 224
Grant Count 201
R01 Count 77
Funding $36,512,779.1
PubMed Score 1470.61
PubTator Score 915.08

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P16422 P18180 Q6FG26 Q6FG49 Q96C47 Q9UCD0 Ep-CAM
Symbols ESA
KSA
M4S1
MK-1
DIAR5
EGP-2
EGP40
KS1/4
MIC18
TROP1
EGP314
HNPCC8
TACSTD1

Gene

PANTHER Protein Class (1)

PDB

4MZV  

Gene RIF (202)

PMID Text
26806809 GbR201K-alphaEpCAM(scFv) is a promising novel targeted therapeutic for the treatment of triple negative breast cancer.
26698569 We revealed a new molecular mechanism of MTA1-mediated invasion and metastasis in lung cancer through downstream target EpCAM, and interfering with EpCAM function may be a novel therapeutic strategy for treatment of MTA1-overexpressing lung carcinoma
26609030 Positive staining for CK19 suggests a possible LPC origin of the EpCAM positive hepatocellular carcinoma .
26600538 Lower GA733-2 expression in cancer tissues appeared to correlate with lymph node metastases (P < 0.05). GA733-1 gene expression was significantly higher in cancerous samples
26556851 EpCAM based capture detects and recovers circulating tumor cells from all subtypes of breast cancer except those low claudin expression.
26356670 knockdown of EpCAM can inhibition breast cancer cell growth and metastasis via inhibition of the Ras/Raf/ERK signaling pathway and MMP-9
26317650 Results indicate that the anti-epithelial cell adhesion molecule (EpCAM) monoclonal antibodie can potentially be used for cancer-targeted therapy.
26296970 Data suggest soluble sEpCAM protein in malignant ascites as a potential predictive marker in cancer patients treated with catumaxomab.
26292218 HEPCAM does not have a direct role as an adhesion molecule in carcinoma
26216137 The results provide an important in vivo validation of hEpCAM signaling properties in normal epithelia and offer unique opportunities to further explore the function of this glycoprotein in select pancreatic cell lineages to elicit islet cell expansion.
More...

AA Sequence

MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMK      1 - 70
AEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVR     71 - 140
TYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIA    141 - 210
DVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVV    211 - 280
AGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA                                        281 - 314
//

Text Mined References (226)

PMID Year Title
26806809 2016 Granzyme B-based cytolytic fusion protein targeting EpCAM specifically kills triple negative breast cancer cells in vitro and inhibits tumor growth in a subcutaneous mouse tumor model.
26698569 2015 MTA1-upregulated EpCAM is associated with metastatic behaviors and poor prognosis in lung cancer.
26609030 2015 Cancer stem cells in hepatocellular carcinoma--an immunohistochemical study with histopathological association.
26600538 2015 Expression profile of the GA733 gene family in colorectal cancer: correlation with clinicopathological parameters.
26556851 2015 EpCAM based capture detects and recovers circulating tumor cells from all subtypes of breast cancer except claudin-low.
26356670 2015 By inhibiting Ras/Raf/ERK and MMP-9, knockdown of EpCAM inhibits breast cancer cell growth and metastasis.
26317650 2015 An anti-EpCAM antibody EpAb2-6 for the treatment of colon cancer.
26296970 2015 Detection of soluble EpCAM (sEpCAM) in malignant ascites predicts poor overall survival in patients treated with catumaxomab.
26292218 2015 Cleavage and cell adhesion properties of human epithelial cell adhesion molecule (HEPCAM).
26216137 2015 MMTV/LTR Promoter-Driven Transgenic Expression of EpCAM Leads to the Development of Large Pancreatic Islets.
More...