Property Summary

NCBI Gene PubMed Count 942
PubMed Score 3564.04
PubTator Score 2511.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (9)

Disease Target Count
Metastatic malignant melanoma 9
Disease Target Count P-value
psoriasis 6685 2.57699649975765E-146
ovarian cancer 8492 7.49326386920806E-9
lung cancer 4473 2.6481757235861E-6
osteosarcoma 7933 4.78825539553527E-6
ulcerative colitis 2087 4.92170553791353E-4
chronic lymphosyte leukemia 232 0.00158237404224651
gastric cancer 436 0.00162900782039107
Atopic dermatitis 944 0.00189752684046552
interstitial cystitis 2299 0.00401136191151589
head and neck cancer and chronic obstructive pulmonary disease 237 0.00527521128839176
invasive ductal carcinoma 2950 0.00886453323627568
primary Sjogren syndrome 789 0.00916855646324773
cutaneous lupus erythematosus 1056 0.0207753717668401
colon cancer 1475 0.0260228974130713
Disease Target Count Z-score Confidence
Autoimmune thyroiditis 24 0.0 5.0
Breast cancer 3099 0.0 5.0
Graves' disease 25 0.0 5.0
Disease Target Count Z-score Confidence
diabetes mellitus 1663 4.637 2.3

Expression

  Differential Expression (14)

Disease log2 FC p
gastric cancer 1.300 0.002
cutaneous lupus erythematosus 1.500 0.021
osteosarcoma -2.442 0.000
chronic lymphosyte leukemia 2.400 0.002
Atopic dermatitis 1.500 0.002
colon cancer 1.200 0.026
lung cancer 4.400 0.000
interstitial cystitis 2.300 0.004
primary Sjogren syndrome 1.400 0.009
invasive ductal carcinoma 1.178 0.009
ulcerative colitis 1.400 0.000
ovarian cancer 1.400 0.000
head and neck cancer and chronic obstruc... 1.200 0.005
psoriasis 3.100 0.000

Synonym

Accession P16410 A0N1S0 E9PDH0 O95653 Q0PP65 Q52MC1 Q53TD5 Q5S005 Q8WXJ1 Q96P43 Q9UKN9
Symbols CD
GSE
GRD4
ALPS5
CD152
CTLA-4
IDDM12
CELIAC3

Gene

PANTHER Protein Class (2)

PDB

1AH1   1H6E   1I85   1I8L   2X44   3BX7   3OSK  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (1119)

PMID Text
27118383 the CTLA-4 +49 GG and the haplotype ACGG/ACGG reduced the overall survival in acute leukemia.
26994388 CTLA4 and FCRL3 genes overexpression may play an important role in children suffering from autoimmune thyroiditis.
26963610 +49A/G and CT60 polymorphism of CTLA4 and E33 polymorphism of TG may be genetic risk factors for autoimmune hypothyroidism susceptibility.
26899867 The expression of the CTLA4 gene is significantly up-regulated in patients with pterygium.
26823853 The genotype AA and allele A of CTLA-4 rs231775 polymorphism may have negative effects on hepatocellular carcinoma by modifying the expression and functions of CTLA-4.
26782543 Genetic association of three single nucleotide polymorphisms in the CTLA-4 (rs231775), PTPN22 (rs2476601), and TNF-alpha (rs1800629) genes with susceptibility to the development of type 1 diabetes in Brazilian patients
26782401 no such association was found in the CTLA4 or PDCD1 polymorphisms
26752000 these data demonstrated that addition of MMPI enhanced the effects of anti-CTLA-4 antibody treatment in a mouse model of breast cancer by delaying tumor growth and reducing metastases.
26709093 genetic polymorphism is associated with gastric adenocarcinoma in Chinese population
26656450 This study provides evidence for a role of the CTLA4 3'UTR (AT)n repeat in the increased genetic risk for islet autoimmunity associated with the CTLA4 locus.
More...

AA Sequence

MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVR      1 - 70
VTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYY     71 - 140
LGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPE    141 - 210
CEKQFQPYFIPIN                                                             211 - 223
//

Text Mined References (947)

PMID Year Title
27118383 2016 CTLA-4 polymorphisms and haplotype correlate with survival in ALL after allogeneic stem cell transplantation from related HLA-haplotype-mismatched donor.
26994388 2016 In children with autoimmune thyroiditis CTLA4 and FCRL3 genes--but not PTPN22--are overexpressed when compared to adults.
26963610 2016 Association of Cytotoxic T-Lymphocyte Antigen 4 (CTLA4) and Thyroglobulin (TG) Genetic Variants with Autoimmune Hypothyroidism.
26899867 2016 A novel approach to investigation of the pathogenesis of pterygium based on assessment of promoter hyper-methylation and expression profile of CTLA4 gene: A credible report of CTLA4 gene expression in human eye tissue.
26823853 2015 Association between CTLA-4 rs231775 polymorphism and hepatocellular carcinoma susceptibility.
26782543 2015 Association of TNF-?, CTLA4, and PTPN22 polymorphisms with type 1 diabetes and other autoimmune diseases in Brazil.
26782401 2015 Association between PDCD1, CTLA4, and MECP2 gene polymorphisms and systemic lupus erythematosus in the Chinese Northern Han.
26752000 2016 A matrix metalloproteinase inhibitor enhances anti-cytotoxic T lymphocyte antigen-4 antibody immunotherapy in breast cancer by reprogramming the tumor microenvironment.
26709093 2016 Investigation of Cytotoxic T-lymphocyte antigen 4 Polymorphisms in Gastric Cardia Adenocarcinoma.
26656450 Variation in the CTLA4 3'UTR has phenotypic consequences for autoreactive T cells and associates with genetic risk for type 1 diabetes.
More...