Property Summary

Ligand Count 1
NCBI Gene PubMed Count 1,007
PubMed Score 3949.07
PubTator Score 2511.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count
Diarrhea 253
Vasculitis 80
Abdominal Pain 98
Abnormality of the hypothalamus-pituitary axis 12
Abnormality of the oral cavity 4
Adult T-Cell Lymphoma/Leukemia 30
Alopecia 115
Arthralgia 90
Atypical lymphocyte observed 10
Autoimmune Diseases 67
Autoimmune hemolytic anemia 31
Autoimmune thrombocytopenia 22
Bipolar Disorder 666
Brain Ischemia 110
C-reactive protein increased 15
Cellulitis of periorbital region 13
Cerebral Ischemia 37
Chest Pain 38
Chronic Obstructive Airway Disease 37
Coughing 25
Cutaneous plaque 5
Decreased antibody level in blood 35
Dry skin 75
Dystrophia unguium 53
ESR raised 20
Eczema 45
Elevated C-reactive protein level 15
Epistaxis 43
Erythema 58
Exanthema 43
Exfoliative dermatitis 24
Fatigue 182
Fever 138
Flushing 60
Graft-vs-Host Disease 5
Granulomatosis 7
Granulomatosis with polyangiitis 5
Hematuria 36
Hemoptysis 6
Hepatomegaly 285
Hypogammaglobulinemia 35
Idiopathic thrombocytopenia 22
Immune thrombocytopenic purpura 24
Immunologic Deficiency Syndromes 113
Infiltrate of lung 17
Inflammatory abnormality of the eye 10
Irregular hyperpigmentation 33
Juvenile arthritis 126
Lichenification 5
Lymphadenopathy 62
Major Depressive Disorder 301
Malignant neoplasm of skin 15
Nausea and vomiting 97
Palmoplantar keratosis 74
Papule 43
Paranasal Sinus Diseases 34
Periorbital edema 13
Periorbital swelling 13
Peripheral Neuropathy 134
Poikiloderma 14
Proteinuria 144
Pruritus 58
Pulmonary Fibrosis 106
Recurrent intrapulmonary hemorrhage 4
Recurrent respiratory infections 141
Renal glomerular disease 12
Respiratory Insufficiency 132
Respiratory function loss 121
Schizophrenia 1160
Sezary Syndrome 27
Sinusitis 65
Skin Neoplasms 69
Splenomegaly 190
Unipolar Depression 250
Weight decreased 103
Xerosis 75
hypopigmented skin patch 59
Disease Target Count
Metastatic malignant melanoma 9
Disease Target Count Z-score Confidence
Autoimmune thyroiditis 27 0.0 5.0
Breast cancer 3578 0.0 5.0
Graves' disease 24 0.0 5.0
Disease Target Count Z-score Confidence
diabetes mellitus 1728 4.617 2.3

Expression

  Differential Expression (14)

Disease log2 FC p
Atopic dermatitis 1.500 1.9e-03
chronic lymphosyte leukemia 1.100 3.2e-03
colon cancer 1.200 2.6e-02
cutaneous lupus erythematosus 1.500 2.1e-02
gastric cancer 1.300 1.6e-03
head and neck cancer and chronic obstruc... 1.200 5.3e-03
interstitial cystitis 1.300 4.3e-03
invasive ductal carcinoma 1.178 8.9e-03
lung cancer 4.400 2.6e-06
osteosarcoma 1.024 3.1e-04
ovarian cancer 1.400 7.5e-09
primary Sjogren syndrome 1.400 9.2e-03
psoriasis 3.100 2.6e-146
ulcerative colitis 1.400 4.9e-04

Gene RIF (1183)

AA Sequence

MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVR      1 - 70
VTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYY     71 - 140
LGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPE    141 - 210
CEKQFQPYFIPIN                                                             211 - 223
//

Text Mined References (1012)

PMID Year Title