Property Summary

NCBI Gene PubMed Count 39
PubMed Score 95.28
PubTator Score 72.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 9.8e-03
Breast cancer 1.600 1.9e-05
breast carcinoma 1.400 3.3e-17
cystic fibrosis 2.098 3.4e-06
dermatomyositis 1.100 2.2e-03
diabetes mellitus -1.200 8.4e-03
Duchenne muscular dystrophy -1.307 2.7e-08
gastric cancer -1.600 1.2e-03
glioblastoma 1.400 6.4e-03
hepatocellular carcinoma -1.500 3.3e-05
interstitial cystitis 1.500 1.9e-03
invasive ductal carcinoma 2.800 1.1e-02
lung adenocarcinoma 1.800 1.2e-05
lung cancer 1.900 5.1e-04
Multiple myeloma 3.148 1.6e-03
non primary Sjogren syndrome sicca 1.200 2.0e-02
non-small cell lung cancer 1.148 3.7e-08
ovarian cancer 2.100 5.6e-04
pancreatic ductal adenocarcinoma liver m... -1.800 8.3e-03
pediatric high grade glioma 1.300 1.1e-03
pituitary cancer 2.700 6.6e-05
posterior fossa group A ependymoma 1.300 6.7e-05
psoriasis -1.300 9.1e-04
X-linked cerebral adrenoleukodystrophy -1.500 2.6e-02

Gene RIF (17)

AA Sequence

MSETAPAAPAAAPPAEKAPVKKKAAKKAGGTPRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAG      1 - 70
YDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKVKKAGGTKPKKPVGAAKKPKK     71 - 140
AAGGATPKKSAKKTPKKAKKPAAATVTKKVAKSPKKAKVAKPKKAAKSAAKAVKPKAAKPKVVKPKKAAP    141 - 210
KKK                                                                       211 - 213
//

Text Mined References (55)

PMID Year Title