Property Summary

NCBI Gene PubMed Count 35
PubMed Score 89.96
PubTator Score 72.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 3.27825015069235E-17
Duchenne muscular dystrophy 602 2.72445309911682E-8
non-small cell lung cancer 2798 3.71037343486248E-8
cystic fibrosis 1670 3.40468483699254E-6
lung adenocarcinoma 2714 1.20986632512376E-5
Breast cancer 3099 1.92268965122808E-5
hepatocellular carcinoma 550 3.29481215223053E-5
pituitary cancer 1972 6.55640729753216E-5
posterior fossa group A ependymoma 1511 6.67767951783628E-5
interstitial cystitis 2299 7.98640163039116E-5
lung cancer 4473 5.11796264718053E-4
ovarian cancer 8492 5.64449178327893E-4
psoriasis 6685 9.06567833946282E-4
pediatric high grade glioma 2712 0.00105735289122616
gastric cancer 436 0.00124334484636697
Multiple myeloma 1328 0.00161342834308776
dermatomyositis 967 0.00217918537865108
glioblastoma 5572 0.00635170210639102
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0083387381436266
diabetes mellitus 1663 0.00840089270768388
atypical teratoid / rhabdoid tumor 4369 0.00980670907078399
invasive ductal carcinoma 2950 0.0107561043570955
non primary Sjogren syndrome sicca 840 0.0196516623489155
X-linked cerebral adrenoleukodystrophy 115 0.0264392432956634
Disease Target Count Z-score Confidence
progressive supranuclear palsy 674 4.841 2.4

Expression

  Differential Expression (24)

Synonym

Accession P16403 A8K4I2
Symbols H1C
H1.2
H1F2
H1s-1

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA Inparanoid

Gene RIF (15)

PMID Text
25631074 Cellular biotinylated histone cluster 1, H1c (HIST1H1C) protein is incorporated into HIV-1 Gag virus-like particles
24873882 Histone H1.2-T165 post translational modifications are dispensable for chromatin binding and cell proliferation while the H1.4-K26 modifications are essential for proper cell cycle progression.
24525734 Integration with apoptotic intermediates (via C-terminal tail interactions) may constitute a more generalized function of linker histone isoforms in apoptotic cascades.
24476918 H1.2 is less abundant than other histone H1 variants at the transcription start sites of inactive genes, and promoters enriched in H1.2 are different from those enriched in other histone H1 variants and tend to be repressed.
24435047 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
24360965 H1.2 interacts with Cul4A and PAF1 to activate developmental regulatory genes.
22249259 These data suggest that p53 acetylation-H1.2 phosphorylation cascade serves as a unique mechanism for triggering p53-dependent DNA damage response pathways.
21425800 Cellular biotinylated histone cluster 1, H1c (HIST1H1C) protein is incorporated into HIV-1 Gag virus-like particles
20800603 Observational study of gene-disease association. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSETAPAAPAAAPPAEKAPVKKKAAKKAGGTPRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAG      1 - 70
YDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKVKKAGGTKPKKPVGAAKKPKK     71 - 140
AAGGATPKKSAKKTPKKAKKPAAATVTKKVAKSPKKAKVAKPKKAAKSAAKAVKPKAAKPKVVKPKKAAP    141 - 210
KKK                                                                       211 - 213
//

Text Mined References (49)

PMID Year Title
26689747 2016 Role of H1 linker histones in mammalian development and stem cell differentiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24873882 2014 Dynamics and dispensability of variant-specific histone H1 Lys-26/Ser-27 and Thr-165 post-translational modifications.
24525734 2014 The C-terminal domain (CTD) in linker histones antagonizes anti-apoptotic proteins to modulate apoptotic outcomes at the mitochondrion.
24476918 2014 Mapping of six somatic linker histone H1 variants in human breast cancer cells uncovers specific features of H1.2.
24435047 2014 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
24360965 2013 Linker Histone H1.2 cooperates with Cul4A and PAF1 to drive H4K31 ubiquitylation-mediated transactivation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
More...