Property Summary

NCBI Gene PubMed Count 33
PubMed Score 63.76
PubTator Score 36.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia -2.400 3.4e-02
Breast cancer 1.300 9.4e-08
gastric cancer -1.400 1.3e-02
hepatocellular carcinoma -1.100 5.4e-03
lung adenocarcinoma 1.400 3.7e-06
malignant mesothelioma 3.100 1.3e-06
Multiple Sclerosis -1.500 1.6e-05

Gene RIF (11)

AA Sequence

MSETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAA      1 - 70
GYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPK     71 - 140
KVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKV    141 - 210
TKAKKAAPKKK                                                               211 - 221
//

Text Mined References (41)

PMID Year Title