Property Summary

NCBI Gene PubMed Count 32
PubMed Score 59.36
PubTator Score 36.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
Breast cancer 3099 9.44850055589592E-8
malignant mesothelioma 3163 1.28138161704864E-6
lung adenocarcinoma 2714 3.68493964918691E-6
Multiple Sclerosis 498 1.58992761685697E-5
hepatocellular carcinoma 550 0.00540950602254698
gastric cancer 436 0.0131678127838718
acute myeloid leukemia 785 0.0339857801112801
Disease Target Count Z-score Confidence
Ankylosing spondylitis 138 0.0 1.0
Disease Target Count Z-score Confidence
Typhoid fever 22 4.55 2.3
Paratyphoid fever 10 3.524 1.8

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer -1.400 0.013
hepatocellular carcinoma -1.100 0.005
malignant mesothelioma 3.100 0.000
Multiple Sclerosis -1.500 0.000
lung adenocarcinoma 1.400 0.000
acute myeloid leukemia -2.400 0.034
Breast cancer 1.300 0.000

Synonym

Accession P16402 B2R751 Q2M2I2
Symbols H1D
H1.3
H1F3
H1s-2

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse EggNOG Inparanoid
Cow OMA Inparanoid

Gene RIF (10)

PMID Text
25584861 Histone H1 organizes and maintains an extensive protein-protein interaction network in the nucleolus required for nucleolar structure and integrity.
24690621 Tandem affinity purification and mass spectrometry analysis identify H1d associated HIV-1 Gag in 293T cells
24525734 Integration with apoptotic intermediates (via C-terminal tail interactions) may constitute a more generalized function of linker histone isoforms in apoptotic cascades.
24435047 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
21425800 Tandem affinity purification and mass spectrometry analysis identify H1d associated HIV-1 Gag in 293T cells
20846217 Observational study of gene-disease association. (HuGE Navigator)
20685720 overexpression of histone cluster 1 is associated with recurrence in meningiomas.
19893584 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)
15595731 confirmed N-terminal acetylation on all isoforms plus a single internal acetylation site; phosphorylation sites were located on peptides containing the cyclin dependent kinase (CDK) consensus motif

AA Sequence

MSETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAA      1 - 70
GYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPK     71 - 140
KVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKV    141 - 210
TKAKKAAPKKK                                                               211 - 221
//

Text Mined References (39)

PMID Year Title
26689747 2016 Role of H1 linker histones in mammalian development and stem cell differentiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25584861 2015 Proteomic characterization of the nucleolar linker histone H1 interaction network.
24525734 2014 The C-terminal domain (CTD) in linker histones antagonizes anti-apoptotic proteins to modulate apoptotic outcomes at the mitochondrion.
24435047 2014 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22650316 2012 A unified phylogeny-based nomenclature for histone variants.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...