Property Summary

NCBI Gene PubMed Count 32
Grant Count 6
Funding $262,560.61
PubMed Score 59.36
PubTator Score 36.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer -1.400 0.013
hepatocellular carcinoma -1.100 0.005
malignant mesothelioma 3.100 0.000
Multiple Sclerosis -1.500 0.000
lung adenocarcinoma 1.400 0.000
acute myeloid leukemia -2.400 0.034
Breast cancer 1.300 0.000

Gene RIF (10)

PMID Text
25584861 Histone H1 organizes and maintains an extensive protein-protein interaction network in the nucleolus required for nucleolar structure and integrity.
24690621 Tandem affinity purification and mass spectrometry analysis identify H1d associated HIV-1 Gag in 293T cells
24525734 Integration with apoptotic intermediates (via C-terminal tail interactions) may constitute a more generalized function of linker histone isoforms in apoptotic cascades.
24435047 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
21425800 Tandem affinity purification and mass spectrometry analysis identify H1d associated HIV-1 Gag in 293T cells
20846217 Observational study of gene-disease association. (HuGE Navigator)
20685720 overexpression of histone cluster 1 is associated with recurrence in meningiomas.
19893584 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)
15595731 confirmed N-terminal acetylation on all isoforms plus a single internal acetylation site; phosphorylation sites were located on peptides containing the cyclin dependent kinase (CDK) consensus motif

AA Sequence

MSETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAA      1 - 70
GYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPK     71 - 140
KVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKV    141 - 210
TKAKKAAPKKK                                                               211 - 221
//

Text Mined References (39)

PMID Year Title
26689747 2016 Role of H1 linker histones in mammalian development and stem cell differentiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25584861 2015 Proteomic characterization of the nucleolar linker histone H1 interaction network.
24525734 2014 The C-terminal domain (CTD) in linker histones antagonizes anti-apoptotic proteins to modulate apoptotic outcomes at the mitochondrion.
24435047 2014 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22650316 2012 A unified phylogeny-based nomenclature for histone variants.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...