Property Summary

NCBI Gene PubMed Count 42
Grant Count 47
R01 Count 30
Funding $5,056,335.46
PubMed Score 127.32
PubTator Score 982.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
osteosarcoma -1.420 0.000
medulloblastoma, large-cell -1.100 0.007
lung cancer 3.200 0.000
lung adenocarcinoma 1.100 0.000
inflammatory breast cancer 2.000 0.000
non-small cell lung carcinoma 1.400 0.000
psoriasis 1.800 0.000

Gene RIF (12)

PMID Text
25023763 Data indicate that normal ovarian tissues strongly expressed histone H1.5, whereas ovarian granulosa cell tumors (GCTs) weakly expressed this protein; in contrast, PLZF protein expression was not significantly different between both study groups.
24784718 Statistically significant differences in staining patterns were found for histone H1.5, distinguishing leiomyosarcomas from leiomyomas.
24690621 Tandem affinity purification and mass spectrometry analysis identify H1b associated HIV-1 Gag in 293T cells
24435047 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
23416030 Promyelocytic leukemia zinc finger and histone H1.5 differentially stain low- and high-grade pulmonary neuroendocrine tumors
21654845 FoxP3 interacts with H1.5 to alter its binding to target genes to modulate their expression and to program Treg function.
21425800 Tandem affinity purification and mass spectrometry analysis identify H1b associated HIV-1 Gag in 293T cells
20800603 Observational study of gene-disease association. (HuGE Navigator)
19136008 Phosphorylation at threonine 10 appears in prometaphase and disappears in telophase, and that this hyperphosphorylated form of H1.5 is mainly chromatin-bound in metaphase when chromatin condensation is maximal.
16377619 Phosphorylation of human H1 variants occurs nonrandomly during both interphase and mitosis and distinct serine- or threonine-specific kinases are involved in different cell cycle phases.
More...

AA Sequence

MSETAPAETATPAPVEKSPAKKKATKKAAGAGAAKRKATGPPVSELITKAVAASKERNGLSLAALKKALA      1 - 70
AGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGATPK     71 - 140
KAKKAAGAKKAVKKTPKKAKKPAAAGVKKVAKSPKKAKAAAKPKKATKSPAKPKAVKPKAAKPKAAKPKA    141 - 210
AKPKAAKAKKAAAKKK                                                          211 - 226
//

Text Mined References (56)

PMID Year Title
26689747 2016 Role of H1 linker histones in mammalian development and stem cell differentiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25023763 2014 Expression of H1.5 and PLZF in granulosa cell tumors and normal ovarian tissues: a short report.
24784718 2014 Immunohistochemical detection of promyelocytic leukemia zinc finger and histone 1.5 in uterine leiomyosarcoma and leiomyoma.
24435047 2014 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23416030 2013 Promyelocytic leukemia zinc finger and histone H1.5 differentially stain low- and high-grade pulmonary neuroendocrine tumors: a pilot immunohistochemical study.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22956909 2012 Dynamic distribution of linker histone H1.5 in cellular differentiation.
More...