Property Summary

NCBI Gene PubMed Count 43
PubMed Score 134.14
PubTator Score 982.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (8)

Disease log2 FC p
inflammatory breast cancer 2.000 1.8e-04
lung adenocarcinoma 1.100 1.9e-08
lung cancer 1.500 4.2e-04
malignant mesothelioma 1.400 2.2e-04
medulloblastoma, large-cell -1.100 6.7e-03
non-small cell lung carcinoma 1.400 2.6e-20
osteosarcoma -1.420 3.1e-05
psoriasis 1.800 1.0e-05

Gene RIF (12)

AA Sequence

MSETAPAETATPAPVEKSPAKKKATKKAAGAGAAKRKATGPPVSELITKAVAASKERNGLSLAALKKALA      1 - 70
AGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGATPK     71 - 140
KAKKAAGAKKAVKKTPKKAKKPAAAGVKKVAKSPKKAKAAAKPKKATKSPAKPKAVKPKAAKPKAAKPKA    141 - 210
AKPKAAKAKKAAAKKK                                                          211 - 226
//

Text Mined References (57)

PMID Year Title