Property Summary

NCBI Gene PubMed Count 56
Grant Count 242
R01 Count 155
Funding $31,848,005.52
PubMed Score 324.25
PubTator Score 203.28

Knowledge Summary

Patent (41,091)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.200 0.002
ependymoma -1.900 0.000
glioblastoma -2.600 0.000
oligodendroglioma -1.400 0.000
osteosarcoma 1.256 0.000
group 3 medulloblastoma -5.000 0.000
atypical teratoid / rhabdoid tumor -4.600 0.000
medulloblastoma, large-cell -4.500 0.000
primitive neuroectodermal tumor -2.400 0.001
adult high grade glioma -2.500 0.000
pilocytic astrocytoma -1.400 0.000
subependymal giant cell astrocytoma -2.481 0.008

Synonym

Accession P16389 A0A024R0D3 A8K1Z6 Q86XG6
Symbols HK4
MK2
HBK5
NGK1
RBK2
HUKIV
KV1.2
EIEE32

Gene

  TechDev Info (1)

Jing-Ruey Yeh 30 gRNA validated for zebrafish model

Gene RIF (22)

PMID Text
25751627 KCNA2 is a new gene involved in human neurodevelopmental disorders through two different mechanisms, predicting either hyperexcitability or electrical silencing of KV1.2-expressing neurons.
25477152 This gene has not been previously described as a cause of disease in humans, but mutations of the orthologous gene in mice (Kcna2) are known to cause both ataxia and convulsions
25300013 the inhibition of two K(+) channel isoforms, Kv1.2 and KCa3.1, by two drug molecules, lidocaine and TRAM-34, is examined in atomic detail using molecular dynamics simulations.
24782544 Using mutagenesis and analysis of gating currents from gating pore mutations in the Shaker Kv channel, we identified statistically highly significant correlations between VSD function and physicochemical properties of gating pore residues.
24682423 isoform betaII plays a central role in the PKC-dependent regulation of Kv1.5/Kvbeta1.2 channels.
22649228 This study indicated that the T2DM condition leads to potassium channel-mediated peripheral nerve hyperexcitability , thus identifying them as a potential drug target to treat some of the DPN related symptoms.
21906595 The immunoreactivity of potassium channels (Kv1.2) was markedly reduced in the ventral roots, but normal in the dorsal roots of all the amyotrophic lateral sclerosis patients.
21044565 observe for both the open and closed conformations of the Kv1.2 that specific mutations of S4 gating-charge residues destabilize the electrostatic network between helices of the voltage sensor domain
20842544 in addition to its known effect on pore stability, V370 of Kv1.2 is also crucial in controlling ion selectivity.
20584892 Using fluorimetry and gating currents, study of the Kv1.2 voltage sensor domain revealed at least two independent conformational changes in this region in response to depolarization.
More...

AA Sequence

MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFD      1 - 70
PLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPL     71 - 140
PENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTI    141 - 210
GYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPED    211 - 280
AQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE    281 - 350
ADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE    351 - 420
TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYV    421 - 490
NITKMLTDV                                                                 491 - 499
//

Publication (65)

PMID Year Title
27619418 2016 Pore size matters for potassium channel conductance.
26503718 2015 Bimodal regulation of an Elk subfamily K+ channel by phosphatidylinositol 4,5-bisphosphate.
25751627 2015 De novo loss- or gain-of-function mutations in KCNA2 cause epileptic encephalopathy.
25477152 2015 Ataxia and myoclonic epilepsy due to a heterozygous new mutation in KCNA2: proposal for a new channelopathy.
25416956 2014 A proteome-scale map of the human interactome network.
25300013 2014 Mechanisms and energetics of potassium channel block by local anesthetics and antifungal agents.
24782544 2014 Moving gating charges through the gating pore in a Kv channel voltage sensor.
24682423 2014 Isoenzyme-specific regulation of cardiac Kv1.5/Kv?1.2 ion channel complex by protein kinase C: central role of PKC?II.
23769686 2013 Activation of lysophosphatidic acid receptor by gintonin inhibits Kv1.2 channel activity: involvement of tyrosine kinase and receptor protein tyrosine phosphatase ?.
22649228 2012 Altered distribution of juxtaparanodal kv1.2 subunits mediates peripheral nerve hyperexcitability in type 2 diabetes mellitus.
More...