Property Summary

NCBI Gene PubMed Count 21
PubMed Score 9.28
PubTator Score 90.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 6.0e-09
atypical teratoid / rhabdoid tumor 1.200 3.8e-04
ependymoma 1.400 1.2e-10
glioblastoma 1.300 6.4e-07
group 3 medulloblastoma 1.600 3.8e-06
lung cancer 1.200 2.9e-02
malignant mesothelioma 1.600 4.9e-07
medulloblastoma, large-cell 1.500 1.7e-06
pediatric high grade glioma 1.100 2.0e-03
psoriasis -1.100 2.0e-03

Gene RIF (7)

AA Sequence

MAHRPKRTFRQRAADSSDSDGAEESPAEPGAPRELPVPGSAEEEPPSGGGRAQVAGLPHRVRGPRGRGRV      1 - 70
WASSRRATKAAPRADEGSESRTLDVSTDEEDKIHHSSESKDDQGLSSDSSSSLGEKELSSTVKIPDAAFI     71 - 140
QAARRKRELARAQDDYISLDVQHTSSISGMKRESEDDPESEPDDHEKRIPFTLRPQTLRQRMAEESISRN    141 - 210
EETSEESQEDEKQDTWEQQQMRKAVKIIEERDIDLSCGNGSSKVKKFDTSISFPPVNLEIIKKQLNTRLT    211 - 280
LLQETHRSHLREYEKYVQDVKSSKSTIQNLESSSNQALNCKFYKSMKIYVENLIDCLNEKIINIQEIESS    281 - 350
MHALLLKQAMTFMKRRQDELKHESTYLQQLSRKDETSTSGNFSVDEKTQWILEEIESRRTKRRQARVLSG    351 - 420
NCNHQEGTSSDDELPSAEMIDFQKSQGDILQKQKKVFEEVQDDFCNIQNILLKFQQWREKFPDSYYEAFI    421 - 490
SLCIPKLLNPLIRVQLIDWNPLKLESTGLKEMPWFKSVEEFMDSSVEDSKKESSSDKKVLSAIINKTIIP    491 - 560
RLTDFVEFLWDPLSTSQTTSLITHCRVILEEHSTCENEVSKSRQDLLKSIVSRMKKAVEDDVFIPLYPKS    561 - 630
AVENKTSPHSKFQERQFWSGLKLFRNILLWNGLLTDDTLQELGLGKLLNRYLIIALLNATPGPDVVKKCN    631 - 700
QVAACLPEKWFENSAMRTSIPQLENFIQFLLQSAHKLSRSEFRDEVEEIILILVKIKALNQAESFIGEHH    701 - 770
LDHLKSLIKED                                                               771 - 781
//

Text Mined References (29)

PMID Year Title