Property Summary

NCBI Gene PubMed Count 20
Grant Count 45
R01 Count 30
Funding $27,563,514.26
PubMed Score 9.22
PubTator Score 90.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
psoriasis -1.100 0.002
ependymoma 1.400 0.000
glioblastoma 1.400 0.001
sonic hedgehog group medulloblastoma 1.800 0.000
atypical teratoid/rhabdoid tumor 1.900 0.000
medulloblastoma, large-cell 1.500 0.000
lung cancer 3.100 0.000
pediatric high grade glioma 1.400 0.000
pilocytic astrocytoma 1.100 0.000

Gene RIF (6)

PMID Text
24304693 C2ORF3 protein is required for pre-mRNA splicing through its presumable role in efficient intron turnover
20846247 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20189245 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17309879 Observational study of gene-disease association. (HuGE Navigator)
17309879 Study refined the 2p12 candidate region in two populations and report evidence supporting MRPL19 and C2ORF3 as candidate susceptibility genes for dyslexia.

AA Sequence

MAHRPKRTFRQRAADSSDSDGAEESPAEPGAPRELPVPGSAEEEPPSGGGRAQVAGLPHRVRGPRGRGRV      1 - 70
WASSRRATKAAPRADEGSESRTLDVSTDEEDKIHHSSESKDDQGLSSDSSSSLGEKELSSTVKIPDAAFI     71 - 140
QAARRKRELARAQDDYISLDVQHTSSISGMKRESEDDPESEPDDHEKRIPFTLRPQTLRQRMAEESISRN    141 - 210
EETSEESQEDEKQDTWEQQQMRKAVKIIEERDIDLSCGNGSSKVKKFDTSISFPPVNLEIIKKQLNTRLT    211 - 280
LLQETHRSHLREYEKYVQDVKSSKSTIQNLESSSNQALNCKFYKSMKIYVENLIDCLNEKIINIQEIESS    281 - 350
MHALLLKQAMTFMKRRQDELKHESTYLQQLSRKDETSTSGNFSVDEKTQWILEEIESRRTKRRQARVLSG    351 - 420
NCNHQEGTSSDDELPSAEMIDFQKSQGDILQKQKKVFEEVQDDFCNIQNILLKFQQWREKFPDSYYEAFI    421 - 490
SLCIPKLLNPLIRVQLIDWNPLKLESTGLKEMPWFKSVEEFMDSSVEDSKKESSSDKKVLSAIINKTIIP    491 - 560
RLTDFVEFLWDPLSTSQTTSLITHCRVILEEHSTCENEVSKSRQDLLKSIVSRMKKAVEDDVFIPLYPKS    561 - 630
AVENKTSPHSKFQERQFWSGLKLFRNILLWNGLLTDDTLQELGLGKLLNRYLIIALLNATPGPDVVKKCN    631 - 700
QVAACLPEKWFENSAMRTSIPQLENFIQFLLQSAHKLSRSEFRDEVEEIILILVKIKALNQAESFIGEHH    701 - 770
LDHLKSLIKED                                                               771 - 781
//

Publication (28)

PMID Year Title
24304693 2014 Identification of a novel component C2ORF3 in the lariat-intron complex: lack of C2ORF3 interferes with pre-mRNA splicing via intron turnover pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22745009 2012 Multiple loci influencing hippocampal degeneration identified by genome scan.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20846247 2011 Analysis of dyslexia candidate genes in the Raine cohort representing the general Australian population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20189245 2010 Genome-wide association study of childhood acute lymphoblastic leukemia in Korea.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...