Property Summary

NCBI Gene PubMed Count 162
Grant Count 94
R01 Count 70
Funding $8,940,367.86
PubMed Score 181.24
PubTator Score 127.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 1.500 0.000
osteosarcoma 1.277 0.000
astrocytoma 1.100 0.037
tuberculosis and treatment for 6 months 1.300 0.000
lung cancer -1.100 0.044
primary Sjogren syndrome 1.300 0.004
ovarian cancer -1.200 0.003

Synonym

Accession P16333 B7Z751 D3DNE3
Symbols NCK
nck-1
NCKalpha

Gene

PDB

2CI8   2CI9   2CUB   2JS0   2JS2   2JW4  

 GWAS Trait (1)

Gene RIF (63)

PMID Text
27033705 Nck1 and Nck2 Interact with WTIP. Nck1/2 integrates nephrin with the Hippo kinase cascade through association with the adaptor protein WTIP.
26590318 the binding of Nck to the TCR requires partial phosphorylation of CD3epsilon, as it is based on two cooperating interactions.
26554011 Nck was the most potent activator of N-WASP-driven actin assembly.
26163016 TSAD binds to and co-localizes with Nck. Expression of TSAD increases both Nck-Lck and Nck-SLP-76 interaction in T cells.
26157164 Results demonstrate that Nck acts as an important hub integrating angiogenic cues with cytoskeletal changes that enable endothelial apical-basal polarization and lumen formation.
25714462 these data identify Nck as an important mediator of oxidative stress-induced inflammation and a potential therapeutic target for ischemia/reperfusion injury.
25482634 Tir-Intimin interaction recruits the Nck adaptor to a Tir tyrosine phosphorylated residue where it activates neural Wiskott-Aldrich syndrome protein (N-WASP).
25398386 Nck1 depletion induces activation of the PI3K/Akt pathway by attenuating PTP1B protein expression
25359136 SDF1alpha-induced interaction of the adapter proteins Nck and HS1 facilitates actin polymerization and migration in T cells.
25321392 biochemical reconstitution on supported lipid bilayers of protein clusters containing the adhesion receptor Nephrin and its cytoplasmic partners, Nck and N-WASP, is reported.
More...

AA Sequence

MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKN      1 - 70
LKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCS     71 - 140
DGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELN    141 - 210
FEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGN    211 - 280
PWYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTME    281 - 350
ELVEHYKKAPIFTSEQGEKLYLVKHLS                                               351 - 377
//

Text Mined References (178)

PMID Year Title
27033705 2016 Nephrin Suppresses Hippo Signaling through the Adaptor Proteins Nck and WTIP.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26590318 2016 Nck Binds to the T Cell Antigen Receptor Using Its SH3.1 and SH2 Domains in a Cooperative Manner, Promoting TCR Functioning.
26554011 2015 Allosteric N-WASP activation by an inter-SH3 domain linker in Nck.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26163016 2015 T cell specific adaptor protein (TSAd) promotes interaction of Nck with Lck and SLP-76 in T cells.
26157164 2015 Actin remodeling by Nck regulates endothelial lumen formation.
25714462 2015 Recruitment of the adaptor protein Nck to PECAM-1 couples oxidative stress to canonical NF-?B signaling and inflammation.
25482634 2014 Nck adaptors, besides promoting N-WASP mediated actin-nucleation activity at pedestals, influence the cellular levels of enteropathogenic Escherichia coli Tir effector.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
More...