Property Summary

NCBI Gene PubMed Count 163
PubMed Score 186.50
PubTator Score 127.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.100 3.7e-02
lung cancer -1.100 4.4e-02
osteosarcoma 1.277 1.0e-04
ovarian cancer -1.200 2.5e-03
primary Sjogren syndrome 1.300 4.3e-03
psoriasis 1.500 3.1e-04
tuberculosis and treatment for 6 months 1.300 3.3e-05

Gene RIF (64)

AA Sequence

MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKN      1 - 70
LKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCS     71 - 140
DGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELN    141 - 210
FEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGN    211 - 280
PWYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTME    281 - 350
ELVEHYKKAPIFTSEQGEKLYLVKHLS                                               351 - 377
//

Text Mined References (179)

PMID Year Title