Property Summary

NCBI Gene PubMed Count 48
Grant Count 29
R01 Count 22
Funding $2,757,290.46
PubMed Score 26.89
PubTator Score 23.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma -2.300 0.000
posterior fossa group A ependymoma -1.800 0.000
oligodendroglioma -1.600 0.000
glioblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma -1.500 0.000
medulloblastoma, large-cell -2.400 0.000
primitive neuroectodermal tumor -1.700 0.000
non-small cell lung cancer 1.097 0.000
colon cancer -1.100 0.000
adult high grade glioma -2.600 0.000
pilocytic astrocytoma -1.700 0.000
subependymal giant cell astrocytoma -1.605 0.012
spina bifida -1.751 0.032
Pick disease -1.100 0.032
invasive ductal carcinoma -1.300 0.001
ovarian cancer -2.600 0.000

Gene RIF (26)

PMID Text
25286016 These findings therefore provide initial support for the novel mechanistic hypothesis that oxidation-induced global and/or local conformational changes within calcineurin
24086760 HIV-1 gp120-induced dephosphorylation of KV2.1 is dependent on NMDA receptor-mediated activation of protein phosphatase 2B or calcineurin
23888774 lower expression of PPP3CA and PPP3CB genes in atrium myocardium can be related to expressed postinfarction LV remodeling.
22739212 Present findings indicate that downregulation of hemoxygenase-1 expression in neutrophils from hypertensive subjects is likely mediated by CN, which acts by hindering translocation to the nucleus of the transcription factor NRF2.
21664352 The expression of a constitutively active Calcineurin stimulates myoblast differentiation, whereas a Calcineurin antisense has the opposite effect.
21531385 ANXA7, PPP3CB, DNAJC9, and ZMYND17 genes are potential candidate genes for schizophrenia, especially in patients with deficits in sustained attention and executive function.
21423799 A novel-splicing variant of calcineurin Ass CnAss-FK, which is encoded by an intron-retaining mRNA and is deficient in the autoinhibitory domain, is predominantly expressed in mature follicular keratinocytes.
21233773 The C allele of protein phosphatase 3 subunit alpha rs3804358 polymorphism was overrepresented in athletes compared with controls, whereas the T allele of protein phosphatase 3 subunit beta rs3763679 polymorphism was underrepresented in athletes.
21047202 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20700529 two new complementary roles for calcineurin in the regulation of the early UPR (Unfolded Protein Responses)
More...

AA Sequence

MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIA      1 - 70
LRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVL     71 - 140
YLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGG    141 - 210
LSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQN    211 - 280
NNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPY    281 - 350
WLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFS    351 - 420
VLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINE    421 - 490
RMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ                                        491 - 524
//

Text Mined References (51)

PMID Year Title
25286016 2014 Oxidation-induced conformational changes in calcineurin determined by covalent labeling and tandem mass spectrometry.
23888774 [Expression profile of calcineurin pathway genes in myocardium tissues in relation to ischemic heart remodeling in humans].
22739212 2012 Calcineurin expression and activity is regulated by the intracellular redox status and under hypertension in human neutrophils.
22688515 2012 Na(+)/H(+) exchanger 1 directly binds to calcineurin A and activates downstream NFAT signaling, leading to cardiomyocyte hypertrophy.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21664352 2011 P43-dependent mitochondrial activity regulates myoblast differentiation and slow myosin isoform expression by control of Calcineurin expression.
21531385 2011 ANXA7, PPP3CB, DNAJC9, and ZMYND17 genes at chromosome 10q22 associated with the subgroup of schizophrenia with deficits in attention and executive function.
21423799 2011 Expression of a constitutively active calcineurin encoded by an intron-retaining mRNA in follicular keratinocytes.
21233773 2011 Are calcineurin genes associated with athletic status? A function, replication study.
21047202 2010 Using genetic and clinical factors to predict tacrolimus dose in renal transplant recipients.
More...