Property Summary

NCBI Gene PubMed Count 49
PubMed Score 28.24
PubTator Score 23.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -2.600 1.1e-05
astrocytic glioma -1.700 1.7e-02
Astrocytoma, Pilocytic -1.700 1.5e-06
atypical teratoid / rhabdoid tumor -2.400 1.9e-11
colon cancer -1.100 2.8e-05
ependymoma -1.600 2.0e-02
glioblastoma -2.100 1.0e-09
invasive ductal carcinoma -1.300 1.1e-03
medulloblastoma -1.500 1.3e-04
medulloblastoma, large-cell -2.400 2.2e-06
non-small cell lung cancer 1.097 3.0e-17
oligodendroglioma -1.200 5.0e-02
ovarian cancer -2.600 3.3e-13
Pick disease -1.100 3.2e-02
primitive neuroectodermal tumor -1.700 1.1e-04
spina bifida -1.751 3.2e-02
subependymal giant cell astrocytoma -1.605 1.2e-02

Gene RIF (27)

AA Sequence

MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIA      1 - 70
LRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVL     71 - 140
YLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGG    141 - 210
LSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQN    211 - 280
NNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPY    281 - 350
WLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFS    351 - 420
VLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINE    421 - 490
RMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ                                        491 - 524
//

Text Mined References (52)

PMID Year Title