Property Summary

NCBI Gene PubMed Count 256
PubMed Score 0.00
PubTator Score 2524.63

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P16284 A8K3S7 D3DU31 Q6LDA9 Q8TBH1 Q96RF5 Q96RF6 Q9NP65 Q9NPB7 Q9NPG9 Q9NQS9 Q9NQT0 Q9NQT1 Q9NQT2 PECAM-1
Symbols CD31
PECA1
GPIIA'
PECAM-1
endoCAM
CD31/EndoCAM

Gene

PANTHER Protein Class (1)

PDB

2KY5   5C14  

 GWAS Trait (1)

Gene RIF (228)

PMID Text
26841644 Heterogeneity was found in the endothelial cells: their shape, the expression of adhesion molecules(ICAM-1, VCAM-1, and PECAM ), and the adhesion of lymphocytes and monocytes to them changed during the progression of the atherosclerotic process.
26662939 The most significant associations were detected for PECAM1*V/V + DDAH1*C (OR = 4.17 CI 1.56-11.15 Pperm = 0.005)
26607202 PECAM1 plays an important role in the formation of tight junction complex.
26407101 soluble CD38 (sCD38) in seminal plasma increases the capacitation of sperm via specific interactions between sCD38 and the CD31 on the sperm.
26376118 expression levels of CD31/ PECAM1 are deregulated in human glioblastoma multiforme tissue specimens; correlation among CD31/PECAM1 and HIF-1alpha and N-cadherin and ADAM-10, two other markers of aggressiveness in the same tumors
26247531 Report correlation between mast cell tryptase and CD31 expression in odontogenic tumors.
26177067 Radiation-induced stress conditions induce a transient accumulation of granulocytes within the liver by down-regulation/absence of PECAM-1.
26078569 Suggest that CD31 expression correlates with prognosis in gastrointestinal stromal tumors.
25884075 The positive correlation is established between content of polymorphic nuclear monocytes and level of expression of molecules of LFA-1, ICAM-1, LFA-3, and PECAM-1.
25846278 PECAM-1 125C/G polymorphism is associated with deep vein thrombosis.
More...

AA Sequence

MQPRWAQGATMWLGVLLTLLLCSSLEGQENSFTINSVDMKSLPDWTVQNGKNLTLQCFADVSTTSHVKPQ      1 - 70
HQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTTAEYQLLVEGVPSPRVTLDKK     71 - 140
EAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKREKNSRDQNFVILEFPVEEQDRVLSFRCQARI    141 - 210
ISGIHMQTSESTKSELVTVTESFSTPKFHISPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVA    211 - 280
HNRHGNKAVYSVMAMVEHSGNYTCKVESSRISKVSSIVVNITELFSKPELESSFTHLDQGERLNLSCSIP    281 - 350
GAPPANFTIQKEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFE    351 - 420
VIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSE    421 - 490
VLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREKEGKPFYQMTSNATQAFWTKQ    491 - 560
KASKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWKKGLIAVVIIGVIIALLIIAAKCYFLRKAKA    561 - 630
KQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAES    631 - 700
HKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT                                    701 - 738
//

Text Mined References (265)

PMID Year Title
26841644 [Adhesion molecules and mononuclear cell subpopulations in the coronary and pulmonary arteries of patients with coronary heart disease].
26662939 2016 Genotype/allelic combinations as potential predictors of myocardial infarction.
26607202 2015 Platelet endothelial cell adhesion molecule-1 (PECAM1) plays a critical role in the maintenance of human vascular endothelial barrier function.
26407101 2015 Seminal CD38 Enhances Human Sperm Capacitation through Its Interaction with CD31.
26376118 2015 Enhanced expression of CD31/platelet endothelial cell adhesion molecule 1 (PECAM1) correlates with hypoxia inducible factor-1 alpha (HIF-1?) in human glioblastoma multiforme.
26247531 2015 A positive correlation between immunohistochemical expression of CD31 and mast cell tryptase in odontogenic tumors.
26177067 2015 Role of PECAM-1 in radiation-induced liver inflammation.
26078569 2015 Prognostic angiogenic markers (endoglin, VEGF, CD31) and tumor cell proliferation (Ki67) for gastrointestinal stromal tumors.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25884075 2014 [The level of expression of molecules of adhesion on monocytes depending on morphological differentiation of nuclei].
More...