Property Summary

NCBI Gene PubMed Count 278
PubMed Score 0.00
PubTator Score 2524.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
autosomal dominant Emery-Dreifuss muscul... 1.369 4.4e-03
breast carcinoma -1.400 2.7e-04
dermatomyositis 2.300 6.3e-04
Duchenne muscular dystrophy 1.208 2.9e-05
ductal carcinoma in situ -1.100 7.1e-03
esophageal adenocarcinoma 1.100 3.2e-02
glioblastoma 2.100 9.7e-04
interstitial cystitis 2.000 4.5e-03
intraductal papillary-mucinous adenoma (... -1.700 1.1e-04
intraductal papillary-mucinous carcinoma... -1.300 6.4e-04
intraductal papillary-mucinous neoplasm ... -1.500 3.4e-03
invasive ductal carcinoma -1.200 4.5e-03
juvenile dermatomyositis 1.428 1.2e-09
lung adenocarcinoma -1.700 4.8e-14
lung cancer -2.300 9.2e-06
lung carcinoma -2.800 2.0e-24
nephrosclerosis 1.125 9.5e-05
non-small cell lung cancer -2.107 6.6e-19
osteosarcoma -1.828 6.5e-03
ovarian cancer 1.300 1.8e-03
periodontitis 1.200 9.6e-21
Pick disease 1.100 2.9e-02
primary Sjogren syndrome 1.700 3.4e-04
psoriasis -1.100 8.3e-03
pterygium 1.200 1.5e-03
subependymal giant cell astrocytoma 1.561 4.9e-02
tuberculosis 1.700 1.6e-03
ulcerative colitis 1.103 4.3e-02
urothelial carcinoma 1.500 3.3e-02

Protein-protein Interaction (3)

Gene RIF (246)

AA Sequence

MQPRWAQGATMWLGVLLTLLLCSSLEGQENSFTINSVDMKSLPDWTVQNGKNLTLQCFADVSTTSHVKPQ      1 - 70
HQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTTAEYQLLVEGVPSPRVTLDKK     71 - 140
EAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKREKNSRDQNFVILEFPVEEQDRVLSFRCQARI    141 - 210
ISGIHMQTSESTKSELVTVTESFSTPKFHISPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVA    211 - 280
HNRHGNKAVYSVMAMVEHSGNYTCKVESSRISKVSSIVVNITELFSKPELESSFTHLDQGERLNLSCSIP    281 - 350
GAPPANFTIQKEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFE    351 - 420
VIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSE    421 - 490
VLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREKEGKPFYQMTSNATQAFWTKQ    491 - 560
KASKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWKKGLIAVVIIGVIIALLIIAAKCYFLRKAKA    561 - 630
KQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAES    631 - 700
HKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT                                    701 - 738
//

Text Mined References (286)

PMID Year Title