Property Summary

NCBI Gene PubMed Count 101
Grant Count 8
R01 Count 6
Funding $941,564.5
PubMed Score 423.98
PubTator Score 3591.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.426 0.002
astrocytoma 1.800 0.013
glioblastoma 1.800 0.007
atypical teratoid / rhabdoid tumor 1.300 0.000
tuberculosis 1.300 0.000
pancreatic ductal adenocarcinoma liver m... -1.409 0.020
diabetes mellitus -1.200 0.008
pediatric high grade glioma 1.200 0.000
ovarian cancer 2.600 0.000

 GWAS Trait (1)

Gene RIF (46)

PMID Text
26086247 The study proposes an explanation for ELNR1 uncoupling based on the age-related alterations of Neu-1 activity.
25964428 This study shows that moderate widespread expression of betagal in the CNS of GM1 gangliosidosis mice is sufficient to achieve significant biochemical impact with phenotypic amelioration and extension in lifespan
25936995 Identification and analysis of GLB1 mutations in Indian patients with GM1 gangliosidosis.
25876105 Overexpression of the novel senescence marker GLB1 in prostate cancer predicts reduced recurrence of PSA-expressing tumors.
25600812 This study analyzed patient cells with GM1 gangliosidosis and sialidosis. A novel mutation p.E186A is identified in GLB1 gene.
24018455 The activity of serum GAL was significantly higher in colon cancer patients with a history of alcohol and nicotine dependence.
23911047 We observed significant lower values of beta-galactosidase, FUC and tendency to decrease of MAN and GLU concentration in nasal polyps
22908062 beta-galactosidase, considered as a senescence marker, is over-expressed only in specific subtypes of pituitary adenomas, but is also present in carcinomas considered as a group
22763966 In the serum of patients with Lyme disease, GAL activity significantly increased (p = 0.029), and the activity of FUC had a tendency to increase (p = 0.153), compared to the control group.
22234367 In a Turkish population, mutations in GLB1 gene leads to severely deficient enzyme activity and result in infantile phenotype of the GM1 gangliosidosis.
More...

AA Sequence

MPGFLVRILPLLLVLLLLGPTRGLRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLL      1 - 70
KMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLL     71 - 140
EKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHH    141 - 210
LGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQP    211 - 280
HSTIKTEAVASSLYDILARGASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFAL    281 - 350
RNIIQKFEKVPEGPIPPSTPKFAYGKVTLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRT    351 - 420
TLPQDCSNPAPLSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVENMGRVNYGAYIN    421 - 490
DFKGLVSNLTLSSNILTDWTIFPLDTEDAVRSHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPS    491 - 560
GIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDD    561 - 630
PELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSWLDHV                           631 - 677
//

Text Mined References (107)

PMID Year Title
26086247 2015 Uncoupling of Elastin Complex Receptor during In Vitro Aging Is Related to Modifications in Its Intrinsic Sialidase Activity and the Subsequent Lactosylceramide Production.
25964428 2015 Systemic AAV9 gene transfer in adult GM1 gangliosidosis mice reduces lysosomal storage in CNS and extends lifespan.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25936995 2015 Recurrent and novel GLB1 mutations in India.
25876105 2015 Overexpression of the novel senescence marker ?-galactosidase (GLB1) in prostate cancer predicts reduced PSA recurrence.
25600812 2015 Biochemical and molecular characterization of novel mutations in GLB1 and NEU1 in patient cells with lysosomal storage disorders.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24018455 2013 The activity of serum beta-galactosidase in colon cancer patients with a history of alcohol and nicotine dependence: preliminary data.
23911047 Lysosomal exoglycosidases in nasal polyps.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...