Property Summary

NCBI Gene PubMed Count 12
PubMed Score 695.17
PubTator Score 87.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.000 1.5e-06
atypical teratoid / rhabdoid tumor -1.500 2.2e-05
Breast cancer 1.400 2.8e-09
ductal carcinoma in situ -1.200 5.4e-03
ependymoma -1.200 3.3e-05
glioblastoma -1.200 1.0e-04
invasive ductal carcinoma -1.900 8.2e-03
medulloblastoma -1.100 8.8e-03
medulloblastoma, large-cell -1.700 2.5e-04
non-small cell lung cancer -1.217 4.2e-15
osteosarcoma -1.393 1.9e-04
ovarian cancer -2.000 4.0e-09
pancreatic ductal adenocarcinoma liver m... -1.610 2.4e-03
subependymal giant cell astrocytoma 1.249 1.3e-02

Gene RIF (4)

AA Sequence

MAAATAAAALAAADPPPAMPQAAGAGGPTTRRDFYWLRSFLAGGIAGCCAKTTVAPLDRVKVLLQAHNHH      1 - 70
YKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHRLMAGSMA     71 - 140
GMTAVICTYPLDMVRVRLAFQVKGEHSYTGIIHAFKTIYAKEGGFFGFYRGLMPTILGMAPYAGVSFFTF    141 - 210
GTLKSVGLSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKC    211 - 280
LTMRDTMKYVYGHHGIRKGLYRGLSLNYIRCIPSQAVAFTTYELMKQFFHLN                      281 - 332
//

Text Mined References (15)

PMID Year Title