Tbio | Graves disease carrier protein |
Required for the accumulation of coenzyme A in the mitochondrial matrix.
This gene encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. This gene has a possible role in Graves' disease. [provided by RefSeq, Jul 2008]
This gene encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. This gene has a possible role in Graves' disease. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
non-small cell lung cancer | 2890 | 4.2e-15 |
Breast cancer | 3578 | 2.8e-09 |
ovarian cancer | 8520 | 4.0e-09 |
adult high grade glioma | 3801 | 1.5e-06 |
atypical teratoid / rhabdoid tumor | 5112 | 2.2e-05 |
ependymoma | 4679 | 3.3e-05 |
glioblastoma | 5792 | 1.0e-04 |
osteosarcoma | 7950 | 1.9e-04 |
medulloblastoma, large-cell | 6241 | 2.5e-04 |
pancreatic ductal adenocarcinoma liver metastasis | 1962 | 2.4e-03 |
ductal carcinoma in situ | 1745 | 5.4e-03 |
invasive ductal carcinoma | 2951 | 8.2e-03 |
medulloblastoma | 720 | 8.8e-03 |
subependymal giant cell astrocytoma | 2287 | 1.3e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Subclavian artery aneurysm | 7 | 3.654 | 1.8 |
Cerebrovascular disease | 238 | 3.496 | 1.7 |
Hemometra | 6 | 3.273 | 1.6 |
Sphenoid sinusitis | 4 | 3.265 | 1.6 |
Lemierre's syndrome | 1 | 3.061 | 1.5 |
Cranial nerve palsy | 4 | 3.003 | 1.5 |
Disease | log2 FC | p |
---|---|---|
adult high grade glioma | -2.000 | 1.5e-06 |
atypical teratoid / rhabdoid tumor | -1.500 | 2.2e-05 |
Breast cancer | 1.400 | 2.8e-09 |
ductal carcinoma in situ | -1.200 | 5.4e-03 |
ependymoma | -1.200 | 3.3e-05 |
glioblastoma | -1.200 | 1.0e-04 |
invasive ductal carcinoma | -1.900 | 8.2e-03 |
medulloblastoma | -1.100 | 8.8e-03 |
medulloblastoma, large-cell | -1.700 | 2.5e-04 |
non-small cell lung cancer | -1.217 | 4.2e-15 |
osteosarcoma | -1.393 | 1.9e-04 |
ovarian cancer | -2.000 | 4.0e-09 |
pancreatic ductal adenocarcinoma liver m... | -1.610 | 2.4e-03 |
subependymal giant cell astrocytoma | 1.249 | 1.3e-02 |
Species | Source | Disease |
---|---|---|
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA |
MAAATAAAALAAADPPPAMPQAAGAGGPTTRRDFYWLRSFLAGGIAGCCAKTTVAPLDRVKVLLQAHNHH 1 - 70 YKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHRLMAGSMA 71 - 140 GMTAVICTYPLDMVRVRLAFQVKGEHSYTGIIHAFKTIYAKEGGFFGFYRGLMPTILGMAPYAGVSFFTF 141 - 210 GTLKSVGLSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKC 211 - 280 LTMRDTMKYVYGHHGIRKGLYRGLSLNYIRCIPSQAVAFTTYELMKQFFHLN 281 - 332 //