Property Summary

NCBI Gene PubMed Count 12
Grant Count 56
R01 Count 27
Funding $12,893,025.68
PubMed Score 677.98
PubTator Score 87.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma -2.172 0.000
ependymoma -1.200 0.000
glioblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma -1.100 0.009
medulloblastoma, large-cell -1.700 0.000
pancreatic ductal adenocarcinoma liver m... -1.610 0.002
non-small cell lung cancer -1.217 0.000
adult high grade glioma -2.000 0.000
subependymal giant cell astrocytoma 1.249 0.013
Breast cancer 1.400 0.000
ductal carcinoma in situ -1.200 0.005
invasive ductal carcinoma -1.900 0.008
ovarian cancer -2.000 0.000

Synonym

Accession P16260 Q8N2U1 GDC
Symbols GDA
GDC
ML7
hML7
HGT.1
D10S105E

Gene

Gene RIF (4)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAATAAAALAAADPPPAMPQAAGAGGPTTRRDFYWLRSFLAGGIAGCCAKTTVAPLDRVKVLLQAHNHH      1 - 70
YKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHRLMAGSMA     71 - 140
GMTAVICTYPLDMVRVRLAFQVKGEHSYTGIIHAFKTIYAKEGGFFGFYRGLMPTILGMAPYAGVSFFTF    141 - 210
GTLKSVGLSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKC    211 - 280
LTMRDTMKYVYGHHGIRKGLYRGLSLNYIRCIPSQAVAFTTYELMKQFFHLN                      281 - 332
//

Text Mined References (15)

PMID Year Title
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...