Property Summary

NCBI Gene PubMed Count 41
Grant Count 106
R01 Count 67
Funding $15,498,411.7
PubMed Score 1937.07
PubTator Score 336.77

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P16233 Q5VSQ2 PL
Symbols PL
PTL
PNLIPD

Gene

PANTHER Protein Class (3)

PDB

1LPA   1LPB   1N8S  

Gene RIF (20)

PMID Text
25862608 Presence of methionine at position 221 in the PNLIP protein sequence causes protein misfolding and aggregation.
25239347 In patients with intraductal papillary mucinous neoplasm without a history of pancreatitis, serum pancreatic lipase and amylase outside normal range are associated with risk of malignancy.
24650780 All these findings support the use of YLLIP2 in enzyme replacement therapy for the treatment of pancreatic exocrine insufficiency, a pathological situation in which an acidification of intestinal contents occurs.
24262094 a novel mutation in the PNLIP gene in two brothers with congenital pancreatic lipase deficiency
23918603 Low PNLIP expression is associated with pancreatic cancer.
22393262 Triacylglycerol lipase and alpha-amylase are highly over-expressed in pancreatic cyst fluids in patients with mucinous pancreatic neoplasms.
20150178 Combination of two mutations with a promising one at the entrance of the catalytic cavity (K80E) negatively affected the lipase activity at neutral pH but not that at acidic pH.
20136147 the amplitude of the lid opening measured in solution or in a frozen solution in the presence of amphiphiles
19346257 Trp-107 and Trp-253 contribute to the change in steady state fluorescence that is triggered by mixed micelles of inhibitor and bile salt.
19113953 The disulfide bridge between the hinges of the lid kept the secondary structure of the lid intact, whereas the HPL was completely unfolded.
More...

AA Sequence

MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTNENPNNFQEVA      1 - 70
ADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCICVDWKGGSRTGYTQASQNIRI     71 - 140
VGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDP    141 - 210
SDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNH    211 - 280
LRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDAS    281 - 350
NFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY    351 - 420
NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC                             421 - 465
//

Text Mined References (43)

PMID Year Title
25862608 2015 A novel mutation in PNLIP causes pancreatic triglyceride lipase deficiency through protein misfolding.
25748441 2015 A broad pH range indicator-based spectrophotometric assay for true lipases using tributyrin and tricaprylin.
25239347 2014 Abnormal serum pancreatic enzymes, but not pancreatitis, are associated with an increased risk of malignancy in patients with intraductal papillary mucinous neoplasms.
24650780 2014 An interfacial and comparative in vitro study of gastrointestinal lipases and Yarrowia lipolytica LIP2 lipase, a candidate for enzyme replacement therapy.
24489884 2014 Genome-wide association study of proneness to anger.
24262094 2014 Identification of a novel mutation in the PNLIP gene in two brothers with congenital pancreatic lipase deficiency.
23918603 2013 Integration of metabolomics and transcriptomics revealed a fatty acid network exerting growth inhibitory effects in human pancreatic cancer.
22393262 2012 Glycomic and proteomic profiling of pancreatic cyst fluids identifies hyperfucosylated lactosamines on the N-linked glycans of overexpressed glycoproteins.
20150178 2010 Modification of pancreatic lipase properties by directed molecular evolution.
20136147 2010 Amplitude of pancreatic lipase lid opening in solution and identification of spin label conformational subensembles by combining continuous wave and pulsed EPR spectroscopy and molecular dynamics.
More...