Property Summary

Ligand Count 3
NCBI Gene PubMed Count 42
PubMed Score 2006.76
PubTator Score 336.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

 GWAS Trait (1)

Protein-protein Interaction (7)

Gene RIF (21)

AA Sequence

MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTNENPNNFQEVA      1 - 70
ADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCICVDWKGGSRTGYTQASQNIRI     71 - 140
VGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDP    141 - 210
SDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNH    211 - 280
LRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDAS    281 - 350
NFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY    351 - 420
NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC                             421 - 465
//

Text Mined References (44)

PMID Year Title