Property Summary

NCBI Gene PubMed Count 506
PubMed Score 3982.27
PubTator Score 1826.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
clear cell sarcoma 6

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 1.2e-04
ependymoma 1.400 6.2e-06
Gaucher disease type 3 -1.100 2.7e-03
glioblastoma 1.200 1.2e-02
group 3 medulloblastoma 1.100 3.8e-02
juvenile dermatomyositis 1.083 3.0e-13
medulloblastoma, large-cell 1.500 1.1e-04
osteosarcoma 1.202 7.2e-06
ovarian cancer -1.200 1.1e-04
pediatric high grade glioma 1.100 1.6e-02
Pick disease 1.100 8.0e-05
primary Sjogren syndrome 1.100 3.6e-05
primitive neuroectodermal tumor 1.300 1.3e-05
psoriasis 1.200 1.9e-03
ulcerative colitis -1.131 4.7e-02

Protein-protein Interaction (1)

Gene RIF (443)

AA Sequence

MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVI      1 - 70
QAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILND     71 - 140
LSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMT    141 - 210
NAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAE    211 - 280
EAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD             281 - 341
//

Text Mined References (519)

PMID Year Title