Property Summary

NCBI Gene PubMed Count 45
Grant Count 22
R01 Count 7
Funding $6,080,505.84
PubMed Score 211.59
PubTator Score 93.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
active Crohn's disease -1.244 0.011
ductal carcinoma in situ -1.200 0.000
invasive ductal carcinoma -1.100 0.002
ulcerative colitis -1.600 0.000

Gene RIF (25)

PMID Text
24554194 Results show significant upregulation of LASP1 and SCAD protein levels in acute psychotic bipolar disorder samples.
24485985 Thirteen proteins had significant alteration in protein levels in patients carrying variation c.319C>T in ACADS compared to controls and they belonged to various pathways, such as the antioxidant system and amino acid metabolism.
22004070 IVD mutations in Asian populations are distinct from these in Western populations.
21968293 physiological concentrations of flavin adenine dinucleotide resulted in a spectacular enhancement of the thermal stabilities of SCAD and prevented enzymatic activity loss
21211036 In glucose-tolerant individuals the minor C-allele of rs2014355 of ACADS was associated with reduced measures of glucose-stimulated insulin release during an oral glucose tolerance test.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20554694 Observational study of gene-disease association. (HuGE Navigator)
20376488 Molecular pathogenesis of a novel mutation, G108D, in ACADS identified in subjects with ACADS deficiency.
20371198 We therefore propose that SCAD misfolding leads to production of ROS, which in turn leads to fission and a grain-like structure of the mitochondrial reticulum. This finding indicates a toxic response elicited by misfolded p.Arg83Cys SCAD proteins
More...

AA Sequence

MAAALLARASGPARRALCPRAWRQLHTIYQSVELPETHQMLLQTCRDFAEKELFPIAAQVDKEHLFPAAQ      1 - 70
VKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNNSLYLGPILKFGSKEQKQAWV     71 - 140
TPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEASAAVVFASTDRALQNKGI    141 - 210
SAFLVPMPTPGLTLGKKEDKLGIRGSSTANLIFEDCRIPKDSILGEPGMGFKIAMQTLDMGRIGIASQAL    211 - 280
GIAQTALDCAVNYAENRMAFGAPLTKLQVIQFKLADMALALESARLLTWRAAMLKDNKKPFIKEAAMAKL    281 - 350
AASEAATAISHQAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVIAGHLLRSYRS            351 - 412
//

Text Mined References (47)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25307522 2015 New insights into the peroxisomal protein inventory: Acyl-CoA oxidases and -dehydrogenases are an ancient feature of peroxisomes.
24850141 2014 Metabolic heritability at birth: implications for chronic disease research.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24586186 2014 Genome-wide association study of metabolic traits reveals novel gene-metabolite-disease links.
24554194 2014 Search for peripheral biomarkers in patients affected by acutely psychotic bipolar disorder: a proteomic approach.
24485985 2014 Proteomic investigation of cultivated fibroblasts from patients with mitochondrial short-chain acyl-CoA dehydrogenase deficiency.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22004070 2011 Phenotypic and mutation spectrums of Thai patients with isovaleric acidemia.
21968293 2011 Cofactors and metabolites as potential stabilizers of mitochondrial acyl-CoA dehydrogenases.
More...