Property Summary

NCBI Gene PubMed Count 47
PubMed Score 240.70
PubTator Score 93.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Short chain Acyl CoA dehydrogenase deficiency 1 0.0 0.0
Disease Target Count P-value
ulcerative colitis 1819 5.5e-07
ductal carcinoma in situ 1745 1.2e-04
invasive ductal carcinoma 2951 1.7e-03
active Crohn's disease 922 1.1e-02
Disease Target Count Z-score Confidence
Short chain acyl-CoA dehydrogenase deficiency 9 0.0 5.0

Expression

  Differential Expression (4)

Disease log2 FC p
active Crohn's disease -1.244 1.1e-02
ductal carcinoma in situ -1.200 1.2e-04
invasive ductal carcinoma -1.100 1.7e-03
ulcerative colitis -1.600 5.5e-07

Protein-protein Interaction (1)

Gene RIF (26)

AA Sequence

MAAALLARASGPARRALCPRAWRQLHTIYQSVELPETHQMLLQTCRDFAEKELFPIAAQVDKEHLFPAAQ      1 - 70
VKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNNSLYLGPILKFGSKEQKQAWV     71 - 140
TPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEASAAVVFASTDRALQNKGI    141 - 210
SAFLVPMPTPGLTLGKKEDKLGIRGSSTANLIFEDCRIPKDSILGEPGMGFKIAMQTLDMGRIGIASQAL    211 - 280
GIAQTALDCAVNYAENRMAFGAPLTKLQVIQFKLADMALALESARLLTWRAAMLKDNKKPFIKEAAMAKL    281 - 350
AASEAATAISHQAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVIAGHLLRSYRS            351 - 412
//

Text Mined References (49)

PMID Year Title