Property Summary

NCBI Gene PubMed Count 63
Grant Count 42
R01 Count 23
Funding $3,075,320.26
PubMed Score 96.21
PubTator Score 271.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (33)

PMID Text
26499922 These results suggest that CR1 induces apoptosis by activating the caspase pathway via binding to TNFR1.
26381805 Critical insights into the substrate selectivity of hCBR1 and the interaction between hCBR1 and glutathione.
26328486 Up-Regulation of Carbonyl Reductase 1 Renders Development of Doxorubicin Resistance in Human Gastrointestinal Cancers
26282591 Results demonstrate a trend toward decreased functional expression of selective hepatic reductases in ESRD livers.
25572536 CBR1 decreases promoted tumor proliferation and growth as well as invasion and metastasis; CBR1 has potential to become a new candidate for molecular targeting therapy.
25541467 Inhibition of CBR1 may increase the efficacy of daunorubicin in cancer tissue.
25526449 Protein products of AKR1C1, AKR1C2, AKR7A3, CYP3A4, and carbonyl reductase (CBR1) were found in tumors and those of AKR1C1, AKR7A3, and CBR1 correlated with their transcript levels.
24654784 The stimulatory effect of cortisol on CBR1 expression may partly explain the concurrent increases of cortisol and prostaglandin PGF2alpha in human amnion tissue prior to the onset of labor
24440593 we suggest that PEP-1-CBR1 protein may be a therapeutic agent for the treatment of ischemic injuries as well as oxidative-stress-induced cell damage and death.
23295225 GSNO-induced covalent modification of cysteine residues affects the kinetic mechanism of CBR1.
More...

AA Sequence

MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSI      1 - 70
RALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSS     71 - 140
IMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHAR    141 - 210
KLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW       211 - 277
//

Text Mined References (68)

PMID Year Title
26499922 2015 Inhibitory effect of carbonyl reductase 1 on ovarian cancer growth via tumor necrosis factor receptor signaling.
26381805 2015 Structural insights on the catalytic site protection of human carbonyl reductase 1 by glutathione.
26328486 2015 Up-Regulation of Carbonyl Reductase 1 Renders Development of Doxorubicin Resistance in Human Gastrointestinal Cancers.
26282591 2015 Downregulation of Hepatic Carbonyl Reductase Type 1 in End-Stage Renal Disease.
25572536 2015 Decreased expression of carbonyl reductase 1 promotes ovarian cancer growth and proliferation.
25541467 2015 Curcumin is a tight-binding inhibitor of the most efficient human daunorubicin reductase--Carbonyl reductase 1.
25526449 2014 The role of cytochromes p450 and aldo-keto reductases in prognosis of breast carcinoma patients.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24654784 2014 Induction of PGF2? synthesis by cortisol through GR dependent induction of CBR1 in human amnion fibroblasts.
24440593 2014 Neuroprotective effects of PEP-1-carbonyl reductase 1 against oxidative-stress-induced ischemic neuronal cell damage.
More...