Property Summary

Ligand Count 7
NCBI Gene PubMed Count 67
PubMed Score 106.83
PubTator Score 271.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (37)

AA Sequence

MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSI      1 - 70
RALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSS     71 - 140
IMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHAR    141 - 210
KLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW       211 - 277
//

Text Mined References (72)

PMID Year Title