Property Summary

NCBI Gene PubMed Count 68
PubMed Score 621.16
PubTator Score 388.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis -1.400 0.007
psoriasis -2.600 0.000
osteosarcoma -4.172 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.100 0.002
medulloblastoma, large-cell -1.200 0.000
pancreatic ductal adenocarcinoma liver m... 1.579 0.003
adult high grade glioma -1.600 0.001
lung carcinoma -2.000 0.000
non-small cell lung carcinoma -1.100 0.000

Synonym

Accession P16150 A8K9B1
Symbols LSN
CD43
GALGP
GPL115

Gene

SPN

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

Gene RIF (49)

PMID Text
25980612 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of SPN against production of infectious wild-type HIV-1
25682152 CD43 expression is a novel adverse prognostic factor for patients with diffuse large B-cell lymphomas
25551301 Forty percent of adenoid cystic carcinomas showed staining for CD43, while no cases of basal cell carcinoma were positive
25320329 Host membrane protein PSGL-1, CD43, and CD44 association with assembling HIV-1 Gag is driven by polybasic sequences present in the cytoplasmic tails of the membrane proteins and in Gag.
25320329 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of SPN against production of infectious wild-type HIV-1
25078322 CD43 polymorphisms are associated with TB susceptibility.
24356816 When used as vaccine in mice, the 2/165 phagotope raised antibodies against the UN1/CD43 antigen, indicating that the 2/165 phagotope mimicked the UN1 antigen structure, and could represent a novel immunogen for cancer immunotherapy
24260485 CD43 promotes cells transformation by preventing merlin-mediated contact inhibition of growth.
23867815 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of SPN against production of infectious wild-type HIV-1
23617469 We conclude that CD43 is an adverse prognostic marker in DLBCL, and is preferentially expressed in the non-GCB subgroup.
More...

AA Sequence

MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTS      1 - 70
INEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSP     71 - 140
ETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTG    141 - 210
SLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRR    211 - 280
QKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRK    281 - 350
SRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP                        351 - 400
//

Text Mined References (76)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25682152 2015 CD43 expression in diffuse large B-cell lymphoma, not otherwise specified: CD43 is a marker of adverse prognosis.
25551301 2015 CD117 and CD43 are useful adjuncts in the distinction of adenoid cystic carcinoma from adenoid basal cell carcinoma.
25320329 2015 Basic motifs target PSGL-1, CD43, and CD44 to plasma membrane sites where HIV-1 assembles.
25078322 2015 Common polymorphisms in the CD43 gene region are associated with tuberculosis disease and mortality.
24356816 2014 Cancer-associated CD43 glycoforms as target of immunotherapy.
24260485 2013 CD43 promotes cells transformation by preventing merlin-mediated contact inhibition of growth.
23617469 2013 CD43 expression is associated with inferior survival in the non-germinal centre B-cell subgroup of diffuse large B-cell lymphoma.
23400223 2013 Macrophage recognition of cells with elevated calcium is mediated by carbohydrate chains of CD43.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...