Property Summary

NCBI Gene PubMed Count 68
Grant Count 229
R01 Count 159
Funding $36,020,839.83
PubMed Score 621.16
PubTator Score 388.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis -1.400 0.007
psoriasis -2.600 0.000
osteosarcoma -4.172 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.100 0.002
medulloblastoma, large-cell -1.200 0.000
pancreatic ductal adenocarcinoma liver m... 1.579 0.003
adult high grade glioma -1.600 0.001
lung carcinoma -2.000 0.000
non-small cell lung carcinoma -1.100 0.000

Synonym

Accession P16150 A8K9B1
Symbols LSN
CD43
GALGP
GPL115

Gene

SPN

Gene RIF (55)

PMID Text
25980612 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of SPN against production of infectious wild-type HIV-1
25980612 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of SPN against production of infectious wild-type HIV-1
25980612 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of SPN against production of infectious wild-type HIV-1
25682152 CD43 expression is a novel adverse prognostic factor for patients with diffuse large B-cell lymphomas
25551301 Forty percent of adenoid cystic carcinomas showed staining for CD43, while no cases of basal cell carcinoma were positive
25320329 Host membrane protein PSGL-1, CD43, and CD44 association with assembling HIV-1 Gag is driven by polybasic sequences present in the cytoplasmic tails of the membrane proteins and in Gag.
25320329 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of SPN against production of infectious wild-type HIV-1
25320329 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of SPN against production of infectious wild-type HIV-1
25320329 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of SPN against production of infectious wild-type HIV-1
25078322 CD43 polymorphisms are associated with TB susceptibility.
More...

AA Sequence

MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTS      1 - 70
INEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSP     71 - 140
ETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTG    141 - 210
SLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRR    211 - 280
QKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRK    281 - 350
SRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP                        351 - 400
//

Text Mined References (76)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25682152 2015 CD43 expression in diffuse large B-cell lymphoma, not otherwise specified: CD43 is a marker of adverse prognosis.
25551301 2015 CD117 and CD43 are useful adjuncts in the distinction of adenoid cystic carcinoma from adenoid basal cell carcinoma.
25320329 2015 Basic motifs target PSGL-1, CD43, and CD44 to plasma membrane sites where HIV-1 assembles.
25078322 2015 Common polymorphisms in the CD43 gene region are associated with tuberculosis disease and mortality.
24356816 2014 Cancer-associated CD43 glycoforms as target of immunotherapy.
24260485 2013 CD43 promotes cells transformation by preventing merlin-mediated contact inhibition of growth.
23617469 2013 CD43 expression is associated with inferior survival in the non-germinal centre B-cell subgroup of diffuse large B-cell lymphoma.
23400223 2013 Macrophage recognition of cells with elevated calcium is mediated by carbohydrate chains of CD43.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...