Property Summary

NCBI Gene PubMed Count 70
PubMed Score 632.37
PubTator Score 388.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.600 6.7e-04
atypical teratoid / rhabdoid tumor -1.400 4.4e-06
glioblastoma -1.100 2.3e-03
lung carcinoma -2.000 1.5e-22
medulloblastoma, large-cell -1.200 5.7e-05
non-small cell lung carcinoma -1.100 1.1e-26
osteosarcoma -1.236 2.5e-04
pancreatic ductal adenocarcinoma liver m... 1.579 2.6e-03
psoriasis -2.300 2.4e-05
Rheumatoid arthritis -1.400 7.0e-03

Gene RIF (51)

AA Sequence

MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTS      1 - 70
INEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSP     71 - 140
ETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTG    141 - 210
SLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRR    211 - 280
QKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRK    281 - 350
SRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP                        351 - 400
//

Text Mined References (78)

PMID Year Title