Property Summary

NCBI Gene PubMed Count 212
PubMed Score 177.41
PubTator Score 134.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
ANONYCHIA 20
Abdomen distended 43
Abnormal pigmentation 25
Abnormality of the stomach 2
Accessory kidney 5
Adenoid Cystic Carcinoma 99
Adult junctional epidermolysis bullosa (disorder) 5
Anemia 365
Aplasia Cutis Congenita 14
Aplasia of the bladder 3
Arthrogryposis 54
Atrophic scar 18
Autosomal recessive predisposition 1442
Axillary pterygia 6
Congenital pyloric atresia 3
Congenital scar 13
Death in early childhood 82
Death in infancy 82
Decreased joint mobility 53
Defective enamel matrix 35
Deglutition Disorders 132
Dehydration 40
Dental Enamel Hypoplasia 43
Dental caries 164
Diarrhea, intractable 6
Disorder of the genitourinary system 6
Dysplasia of tooth enamel 35
Dystrophia unguium 53
Ectropion 38
Elevated maternal serum alpha-fetoprotein 4
Esophageal atresia 43
Failure to gain weight 365
Flexion contracture of proximal interphalangeal joint 75
Fragile nails 16
Fragile skin 18
Genitourinary dysplasia 6
Glomerulosclerosis (disorder) 7
Hemoglobin low 124
Hydronephrosis 89
Hypodontia 81
Intestinal atresia 12
Junctional split 6
Milium Cyst 16
Nail dysplasia 52
Nausea and vomiting 97
Oral mucosal blistering 10
Palmar hyperhidrosis 5
Palmoplantar blistering 3
Pediatric failure to thrive 365
Plantar hyperkeratosis 7
Polyhydramnios 108
Premature Birth 77
Premature birth of newborn 67
Prenatal onset 139
RENAL ADYSPLASIA 25
Recurrent skin infections 21
Renal dysplasia 28
Rotting teeth 73
Scarring alopecia of scalp 13
Septicemia 6
Skin Erosion 12
Sparse body hair 32
Spontaneous abortion 113
Thin dental enamel 35
Ureterocele 14
Urethral Stricture 18
Urogenital Abnormalities 9
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Junctional epidermolysis bullosa with pyloric atresia 3 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2499 3.839 1.9

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.100 3.4e-02
astrocytic glioma 1.400 3.6e-03
Astrocytoma, Pilocytic 1.100 1.1e-03
Down syndrome 1.100 1.4e-03
ependymoma 2.800 2.7e-02
glioblastoma 1.700 1.5e-02
group 4 medulloblastoma -1.600 2.2e-03
interstitial cystitis -1.300 7.5e-03
lung adenocarcinoma 1.200 4.0e-07
lung cancer 1.300 3.1e-03
lung carcinoma -1.100 2.0e-12
malignant mesothelioma 1.700 4.4e-06
medulloblastoma, large-cell -1.200 3.2e-03
non-small cell lung cancer 1.794 6.5e-13
osteosarcoma 1.242 2.3e-04
pancreatic cancer 1.500 2.1e-04
pancreatic ductal adenocarcinoma liver m... 3.071 1.6e-02
psoriasis -1.200 6.6e-04

Gene RIF (146)

AA Sequence

MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRRCNTQAELLAA      1 - 70
GCQRESIVVMESSFQITEETQIDTTLRRSQMSPQGLRVRLRPGEERHFELEVFEPLESPVDLYILMDFSN     71 - 140
SMSDDLDNLKKMGQNLARVLSQLTSDYTIGFGKFVDKVSVPQTDMRPEKLKEPWPNSDPPFSFKNVISLT    141 - 210
EDVDEFRNKLQGERISGNLDAPEGGFDAILQTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGI    211 - 280
MSRNDERCHLDTTGTYTQYRTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQE    281 - 350
DSSNIVELLEEAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTRTGSFHIRRGEVGIYQVQLRALEHVDG    351 - 420
THVCQLPEDQKGNIHLKPSFSDGLKMDAGIICDVCTCELQKEVRSARCSFNGDFVCGQCVCSEGWSGQTC    421 - 490
NCSTGSLSDIQPCLREGEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYDNFQCPRTSGFLCNDRGRCSMG    491 - 560
QCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECGRCHCHQQSLYTDTICEINYSAIHPGLCEDLR    561 - 630
SCVQCQAWGTGEKKGRTCEECNFKVKMVDELKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLV    631 - 700
HKKKDCPPGSFWWLIPLLLLLLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMA    701 - 770
SDHLDTPMLRSGNLKGRDVVRWKVTNNMQRPGFATHAASINPTELVPYGLSLRLARLCTENLLKPDTREC    771 - 840
AQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALLKLTEKQVEQRA    841 - 910
FHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQLLVEAIDVPAGTATLGRRLVN    911 - 980
ITIIKEQARDVVSFEQPEFSVSRGDQVARIPVIRRVLDGGKSQVSYRTQDGTAQGNRDYIPVEGELLFQP    981 - 1050
GEAWKELQVKLLELQEVDSLLRGRQVRRFHVQLSNPKFGAHLGQPHSTTIIIRDPDELDRSFTSQMLSSQ   1051 - 1120
PPPHGDLGAPQNPNAKAAGSRKIHFNWLPPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYC   1121 - 1190
DYEMKVCAYGAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLV   1191 - 1260
NDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPMSIPIIP   1261 - 1330
DIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSVSDDTGCGWKFEPLLGEELDLRRVTWRLPPELIPRL   1331 - 1400
SASSGRSSDAEAPHGPPDDGGAGGKGGSLPRSATPGPPGEHLVNGRMDFAFPGSTNSLHRMTTTSAAAYG   1401 - 1470
THLSPHVPHRVLSTSSTLTRDYNSLTRSEHSHSTTLPRDYSTLTSVSSHDSRLTAGVPDTPTRLVFSALG   1471 - 1540
PTSLRVSWQEPRCERPLQGYSVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGR   1541 - 1610
EREGVITIESQVHPQSPLCPLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEM   1611 - 1680
AQGGGPATAFRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQLGSRAG   1681 - 1750
LFQHPLQSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQEFVSRTLTTSGTLSTHMDQQFF   1751 - 1820
QT                                                                       1821 - 1822
//

Text Mined References (218)

PMID Year Title