Property Summary

NCBI Gene PubMed Count 200
Grant Count 26
R01 Count 19
Funding $3,773,449.59
PubMed Score 165.73
PubTator Score 134.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 4.100 0.000
astrocytic glioma 1.400 0.004
posterior fossa group A ependymoma 3.200 0.000
psoriasis -1.200 0.001
glioblastoma 1.700 0.015
osteosarcoma -2.810 0.000
group 4 medulloblastoma -1.600 0.002
medulloblastoma, large-cell -1.200 0.003
pancreatic ductal adenocarcinoma liver m... 3.071 0.016
non-small cell lung cancer 2.079 0.000
lung cancer 2.500 0.000
pancreatic cancer 1.900 0.000
interstitial cystitis -1.300 0.008
lung adenocarcinoma 1.200 0.000
pediatric high grade glioma 1.300 0.010
pilocytic astrocytoma 1.600 0.000
lung carcinoma -1.100 0.000
Down syndrome 1.100 0.001

Gene RIF (135)

PMID Text
26646105 High vimentin and low beta4 integrin protein levels are associated with poor survival in oral squamous carcinoma patients.
26580203 PKD2 and RSK1 regulate integrin beta4 phosphorylation at threonine 1736 to stabilize keratinocyte cell adhesion and its hemidesmosomes.
26572585 Endothelial cell overexpression of mutant ITGB4 with specific tyrosines mutated to phenylalanine (Y1440, Y1526 Y1640, or Y1422) resulted in significantly attenuated CS-induced cytokine expression.
26549523 This study describes a pro-metastatic EGFR/Src-dependent beta4 integrin/FAK complex that is involved in breast cancer malignancy and is a novel therapeutic target for triple-negative breast cancer.
26395630 Changes in beta-integrins gene expression in human prostate cancer cells following ITGB4 knockdown.
26381405 integrin alpha6beta4 stimulates invasion by promoting autocrine EGFR signaling through transcriptional up-regulation of key EGFR family members and by facilitating HGF-stimulated EGFR ligand secretion
26350464 syndecans remain anchored to the alpha6beta4 integrin via its cytoplasmic domain, but the activation of cell motility is disrupted
26223322 These data suggest that the p53(R248) mutant endows ovarian cancer cells with increased adhesiveness and that integrin beta4 and Akt signalling are associated with the mutation-enhanced ovarian cancer-mesothelial cell adhesion.
26037302 ITGB4 stimulation leads to recruitment of 12-LOX from the cytosol to the membrane.
25997717 Analysis showed that ITGB4 and VCL were upregulated in exosomes derived from taxane-resistant prostate cancer cells suggesting them as useful markers for progression of prostate cancer associated with taxane-resistance.
More...

AA Sequence

MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRRCNTQAELLAA      1 - 70
GCQRESIVVMESSFQITEETQIDTTLRRSQMSPQGLRVRLRPGEERHFELEVFEPLESPVDLYILMDFSN     71 - 140
SMSDDLDNLKKMGQNLARVLSQLTSDYTIGFGKFVDKVSVPQTDMRPEKLKEPWPNSDPPFSFKNVISLT    141 - 210
EDVDEFRNKLQGERISGNLDAPEGGFDAILQTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGI    211 - 280
MSRNDERCHLDTTGTYTQYRTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQE    281 - 350
DSSNIVELLEEAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTRTGSFHIRRGEVGIYQVQLRALEHVDG    351 - 420
THVCQLPEDQKGNIHLKPSFSDGLKMDAGIICDVCTCELQKEVRSARCSFNGDFVCGQCVCSEGWSGQTC    421 - 490
NCSTGSLSDIQPCLREGEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYDNFQCPRTSGFLCNDRGRCSMG    491 - 560
QCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECGRCHCHQQSLYTDTICEINYSAIHPGLCEDLR    561 - 630
SCVQCQAWGTGEKKGRTCEECNFKVKMVDELKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLV    631 - 700
HKKKDCPPGSFWWLIPLLLLLLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMA    701 - 770
SDHLDTPMLRSGNLKGRDVVRWKVTNNMQRPGFATHAASINPTELVPYGLSLRLARLCTENLLKPDTREC    771 - 840
AQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALLKLTEKQVEQRA    841 - 910
FHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQLLVEAIDVPAGTATLGRRLVN    911 - 980
ITIIKEQARDVVSFEQPEFSVSRGDQVARIPVIRRVLDGGKSQVSYRTQDGTAQGNRDYIPVEGELLFQP    981 - 1050
GEAWKELQVKLLELQEVDSLLRGRQVRRFHVQLSNPKFGAHLGQPHSTTIIIRDPDELDRSFTSQMLSSQ   1051 - 1120
PPPHGDLGAPQNPNAKAAGSRKIHFNWLPPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYC   1121 - 1190
DYEMKVCAYGAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLV   1191 - 1260
NDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPMSIPIIP   1261 - 1330
DIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSVSDDTGCGWKFEPLLGEELDLRRVTWRLPPELIPRL   1331 - 1400
SASSGRSSDAEAPHGPPDDGGAGGKGGSLPRSATPGPPGEHLVNGRMDFAFPGSTNSLHRMTTTSAAAYG   1401 - 1470
THLSPHVPHRVLSTSSTLTRDYNSLTRSEHSHSTTLPRDYSTLTSVSSHDSRLTAGVPDTPTRLVFSALG   1471 - 1540
PTSLRVSWQEPRCERPLQGYSVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGR   1541 - 1610
EREGVITIESQVHPQSPLCPLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEM   1611 - 1680
AQGGGPATAFRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQLGSRAG   1681 - 1750
LFQHPLQSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQEFVSRTLTTSGTLSTHMDQQFF   1751 - 1820
QT                                                                       1821 - 1822
//

Text Mined References (206)

PMID Year Title
26646105 2016 Vimentin-mediated regulation of cell motility through modulation of beta4 integrin protein levels in oral tumor derived cells.
26580203 2015 PKD2 and RSK1 Regulate Integrin ?4 Phosphorylation at Threonine 1736.
26572585 2015 Role of Integrin ?4 in Lung Endothelial Cell Inflammatory Responses to Mechanical Stress.
26549523 2015 An EGFR/Src-dependent ?4 integrin/FAK complex contributes to malignancy of breast cancer.
26395630 2015 Suppression of ITGB4 Gene Expression in PC-3 Cells with Short Interfering RNA Induces Changes in the Expression of ?-Integrins Associated with RGD-Receptors.
26381405 2015 Integrin ?6?4 Promotes Autocrine Epidermal Growth Factor Receptor (EGFR) Signaling to Stimulate Migration and Invasion toward Hepatocyte Growth Factor (HGF).
26350464 2015 Syndecan-1 and Syndecan-4 Capture Epidermal Growth Factor Receptor Family Members and the ?3?1 Integrin Via Binding Sites in Their Ectodomains: NOVEL SYNSTATINS PREVENT KINASE CAPTURE AND INHIBIT ?6?4-INTEGRIN-DEPENDENT EPITHELIAL CELL MOTILITY.
26223322 2015 Mutant p53 promotes ovarian cancer cell adhesion to mesothelial cells via integrin ?4 and Akt signals.
26037302 2015 Convergence of eicosanoid and integrin biology: 12-lipoxygenase seeks a partner.
25997717 2015 Integrin ?4 and vinculin contained in exosomes are potential markers for progression of prostate cancer associated with taxane-resistance.
More...