Property Summary

NCBI Gene PubMed Count 18
PubMed Score 17.60
PubTator Score 17.41

Knowledge Summary

Patent (886)

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.7e-09
ductal carcinoma in situ 1745 1.4e-03
invasive ductal carcinoma 2951 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
ductal carcinoma in situ -1.700 1.4e-03
invasive ductal carcinoma -1.600 2.2e-02
ovarian cancer 1.100 2.7e-09

 IMPC Phenotype (1)

Gene RIF (3)

AA Sequence

MSPEMGELTQTRLQKIWIPHSSGSSRLQRRRGSSIPQFTNSPTMVIMVGLPARGKTYISTKLTRYLNWIG      1 - 70
TPTKVFNLGQYRREAVSYKNYEFFLPDNMEALQIRKQCALAALKDVHNYLSHEEGHVAVFDATNTTRERR     71 - 140
SLILQFAKEHGYKVFFIESICNDPGIIAENIRQVKLGSPDYIDCDREKVLEDFLKRIECYEVNYQPLDEE    141 - 210
LDSHLSYIKIFDVGTRYMVNRVQDHIQSRTVYYLMNIHVTPRSIYLCRHGESELNIRGRIGGDSGLSVRG    211 - 280
KQYAYALANFIQSQGISSLKVWTSHMKRTIQTAEALGVPYEQWKALNEIDAGVCEEMTYEEIQEHYPEEF    281 - 350
ALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLH    351 - 420
TVLKLTPVAYGCKVESIYLNVEAVNTHREKPENVDITREPEEALDTVPAHY                       421 - 471
//

Text Mined References (20)

PMID Year Title