Property Summary

NCBI Gene PubMed Count 356
Grant Count 864
R01 Count 467
Funding $100,781,549.94
PubMed Score 3891.79
PubTator Score 3027.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (55)

Disease Z-score Confidence
Coronary artery disease 240 5.909 3.0
Atherosclerosis 275 5.573 2.8
Thrombocytopenia 105 5.183 2.6
Cerebrovascular disease 231 5.169 2.6
Hypertension 287 4.603 2.3
Heart disease 279 4.404 2.2
diabetes mellitus 1,663 4.316 2.2
Cancer 2,346 3.955 2.0
Kidney disease 396 3.899 1.9
Intermittent claudication 16 3.841 1.9
Peritonitis 37 3.712 1.9
Hypersensitivity reaction type II diseas... 235  3.644 1.8
Inflammatory bowel disease 142 3.627 1.8
Acute pancreatitis 6 3.519 1.8
Thrombophilia 36 3.472 1.7
Peripheral vascular disease 90 3.45 1.7
Peripheral artery disease 8 3.328 1.7
Arthus reaction 8 3.283 1.6
Intracranial arteriosclerosis 1 3.259 1.6
Vasculitis 64 3.228 1.6
Pulmonary Embolism 45 3.199 1.6
Asthma 349 3.058 1.5
Arthritis 248 3.04 1.5
Dermatitis 107 3.006 1.5
ATOPY, SUSCEPTIBILITY TO (finding) 3
Alzheimer's disease 644 2.0
Breast cancer 3,094
Carcinoma 2,147 1.0
Coronary artery disease, premature 1
Depressive disorder 48
Hypersensitivity 63
Hypertensive disease 193
IgE RESPONSIVENESS, ATOPIC 8
Myocardial Ischemia 169
Myocardial Reperfusion Injury 34
Neurobehavioral Manifestations 5
Peripheral Neuropathy 303
Pleurisy 18
Thrombosis 42
cutaneous lupus erythematosus 1,056
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
mucosa-associated lymphoid tissue lympho... 480 
non-small cell lung cancer 2,798
osteosarcoma 7,933
pancreatic cancer 2,300
pancreatic carcinoma 567
ulcerative colitis 2,087

Expression

Synonym

Accession P16109 Q5R344 Q8IVD1
Symbols CD62
GRMP
PSEL
CD62P
GMP140
LECAM3
PADGEM

Gene

PDB

1G1S   1FSB   1G1Q   1G1R   1HES   1KJD  

Gene RIF (333)

PMID Text
26631722 Data (including data from studies in transgenic mice) suggest that sequence variations limited to 1.4-kb proximal promoter region account for most differences in expression of murine Selp and human SELP genes.
26613867 Elevated plasma P-selectin autoantibodies may play a role in the pathogenesis of thrombocytopenia in pSS patients.
26575878 The adhesion molecules CD62P and CD44 play an important role in the pathogenesis of bronchiolitis.
26539491 This study provides a better understanding of the biology of P-selectin and PSGL-1 and their roles in dissemination and resensitization of Multiple myeloma treatment.
26418972 The addition of sialic acid enhances the affinity of CD15 to P-selectin and augments the cell adhesion to blood vessel endothelial cells.
26388436 CD62P levels may be useful as a sensitive clinical marker for the early detection of DWMLs [deep white matter lesions]with cognitive decline.
26344728 P-selectin gene polymorphisms and haplotypes can contribute to proliferative diabetic retinopathy development.
26279254 time changes of sCD40L over 1 month after myocardial infarct onset were associated with G894T eNOS polymorphism and with the VEGF concentrations, but not to the platelet CD62P expression
26261626 Soluble P-selectin was upregulated I ankylosing spondylitis patients could predict prognosis.
26261613 P-selectin polymorphism of -825T/C is associated with the risk of pulmonary hypertension in congenital heart defects, and may be one of its risk factors.
More...

AA Sequence

MANCQIAILYQRFQRVVFGISQLLCFSALISELTNQKEVAAWTYHYSTKAYSWNISRKYCQNRYTDLVAI      1 - 70
QNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPS     71 - 140
APGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVL    141 - 210
MNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAK    211 - 280
AFQHQSSCSFSCEEGFALVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSC    281 - 350
KFECQPGYRVRGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGF    351 - 420
MLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVL    421 - 490
QCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRW    491 - 560
TDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCK    561 - 630
GIASLPTPGLQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACR    631 - 700
AVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQE    701 - 770
ALTYFGGAVASTIGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSP              771 - 830
//

Text Mined References (360)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26631722 2016 Replacing the Promoter of the Murine Gene Encoding P-selectin with the Human Promoter Confers Human-like Basal and Inducible Expression in Mice.
26627825 2016 Extracellular Fibrinogen-binding Protein (Efb) from Staphylococcus aureus Inhibits the Formation of Platelet-Leukocyte Complexes.
26613867 2015 Elevated Plasma P-Selectin Autoantibodies in Primary Sjögren Syndrome Patients with Thrombocytopenia.
26575878 2015 [Expression and significance of adhesion molecules CD62P and CD44 in peripheral blood of infants with bronchiolitis].
26539491 2015 Inhibition of P-Selectin and PSGL-1 Using Humanized Monoclonal Antibodies Increases the Sensitivity of Multiple Myeloma Cells to Bortezomib.
26418972 2015 Hodgkin lymphoma cell lines bind to platelets. Incubation with platelets induces CD15 and P-selectin dependent adhesion of the cell lines to Human Umbilical Vein Endothelial cells (HUVEC).
26388436 CD62-mediated activation of platelets in cerebral white matter lesions in patients with cognitive decline.
26344728 2015 The rs3917779 polymorphism of P-selectin's significant association with proliferative diabetic retinopathy in Yazd, Iran.
26279254 2015 Changes of soluble CD40 ligand in the progression of acute myocardial infarction associate to endothelial nitric oxide synthase polymorphisms and vascular endothelial growth factor but not to platelet CD62P expression.
More...