Property Summary

NCBI Gene PubMed Count 285
Grant Count 435
R01 Count 209
Funding $82,873,583.5
PubMed Score 1458.23
PubTator Score 981.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
ependymoma 1.500 0.027
psoriasis 1.700 0.007
osteosarcoma 1.206 0.001
glioblastoma 1.200 0.027
Atopic dermatitis 1.800 0.000
pancreatic ductal adenocarcinoma liver m... 1.994 0.013
non-small cell lung cancer 1.171 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.012
lung cancer 1.300 0.004
breast carcinoma 2.100 0.000
lung adenocarcinoma 1.400 0.000
invasive ductal carcinoma 1.800 0.003
Endometriosis 1.421 0.010
Breast cancer 1.700 0.000
ductal carcinoma in situ 1.400 0.000
ovarian cancer 2.000 0.000

Synonym

Accession P16104 Q4ZGJ7 Q6IAS5 H2a/x
Symbols H2AX
H2A.X
H2A/X

Gene

PDB

1YDP   2D31   2DYP   3SQD   3SHV   3SZM   3U3Z   2AZM  

Gene RIF (248)

PMID Text
26876487 silencing or removing H2A.X induces mesenchymal-like characteristics including activation of EMT transcription factors, Slug and ZEB1, in HCT116 human colon cancer cells.
26852132 Gene expression analysis identified deregulation of histone H2A and H2B genes in all four cell lines ;histone pathways are associated with epirubicin resistance
26820970 For both, gamma-H2AX and 53BP1, the cellular focus number as well as the percentage of positive cells did not differ between patients with clinically isolated syndrome/early relapsing-remitting multiple sclerosis and healthy controls.
26734725 The interaction of MDC1 with RNF8, but not with ATM requires WRAP53beta, suggesting that WRAP53beta facilitates the former interaction without altering phosphorylation of MDC1 by ATM.
26717153 overexpression of TIPRL promotes phosphorylation of H2AX, and increases gamma-H2AX positive foci in response to DNA damage, whereas knockdown of TIPRL inhibits gamma-H2AX phosphorylation
26711340 Results reveal a pathway controlled by ATM, SIRT6, and SNF2H to block HUWE1, which stabilizes H2AX and induces its incorporation into chromatin only when cells are damaged.
26628370 the interaction of 53BP1 with gammaH2AX is required for sustaining the 53BP1-dependent focal concentration of activated ATM that facilitates repair of DNA double-strand breaks in heterochromatin in G1.
26541290 The study shows higher expression of gamma-H2AX and 53BP1 foci in rectal cancer patients compared with healthy individuals. Yet the data in vitro were not predictive in regard to the radiotherapy outcome.
26507658 These findings elucidate deeply and extensively the mechanism of RNF8/RNF168 and USP11 to maintain the proper status of ubiquitylation gammaH2AX to repair double strand breaks.
26482424 kinetics of the accumulation of selected DNA repair-related proteins is protein specific at locally induced DNA lesions, and that the formation of gH2AX- and NBS1-positive foci, but not 53BP1-positive NBs, is cell cycle dependent in HeLa cells
More...

AA Sequence

MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQAS     71 - 140
QEY                                                                       141 - 143
//

Text Mined References (291)

PMID Year Title
26876487 2016 The histone variant H2A.X is a regulator of the epithelial-mesenchymal transition.
26852132 2016 Downregulation of histone H2A and H2B pathways is associated with anthracycline sensitivity in breast cancer.
26820970 2016 Analysis of Lymphocytic DNA Damage in Early Multiple Sclerosis by Automated Gamma-H2AX and 53BP1 Foci Detection: A Case Control Study.
26734725 2015 The proximity ligation assay reveals that at DNA double-strand breaks WRAP53? associates with ?H2AX and controls interactions between RNF8 and MDC1.
26717153 2015 TIPRL Inhibits Protein Phosphatase 4 Activity and Promotes H2AX Phosphorylation in the DNA Damage Response.
26711340 2015 ATM and SIRT6/SNF2H Mediate Transient H2AX Stabilization When DSBs Form by Blocking HUWE1 to Allow Efficient ?H2AX Foci Formation.
26628370 2015 ATM Localization and Heterochromatin Repair Depend on Direct Interaction of the 53BP1-BRCT2 Domain with ?H2AX.
26541290 2015 A prospective study on histone ?-H2AX and 53BP1 foci expression in rectal carcinoma patients: correlation with radiation therapy-induced outcome.
26507658 2016 USP11 Is a Negative Regulator to ?H2AX Ubiquitylation by RNF8/RNF168.
26482424 2015 Distinct kinetics of DNA repair protein accumulation at DNA lesions and cell cycle-dependent formation of ?H2AX- and NBS1-positive repair foci.
More...