Property Summary

NCBI Gene PubMed Count 317
PubMed Score 1588.88
PubTator Score 981.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
glioblastoma 1.200 2.7e-02
Atopic dermatitis 1.800 4.3e-05
Breast cancer 1.700 3.4e-16
breast carcinoma 2.100 1.2e-05
ductal carcinoma in situ 1.400 2.7e-04
Endometriosis 1.421 9.5e-03
ependymoma 1.500 2.7e-02
intraductal papillary-mucinous neoplasm ... 1.100 1.2e-02
invasive ductal carcinoma -1.017 5.1e-03
lung adenocarcinoma 1.400 2.9e-08
lung cancer 1.300 3.8e-03
malignant mesothelioma 1.600 7.0e-07
non-small cell lung cancer 1.171 5.5e-20
osteosarcoma 1.206 1.3e-03
ovarian cancer 2.000 1.7e-04
pancreatic ductal adenocarcinoma liver m... 1.994 1.3e-02
psoriasis 1.700 6.6e-03

Gene RIF (271)

AA Sequence

MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQAS     71 - 140
QEY                                                                       141 - 143
//

Text Mined References (324)

PMID Year Title