Property Summary

Ligand Count 142
NCBI Gene PubMed Count 64
PubMed Score 86.03
PubTator Score 122.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Marburg hemorrhagic fever 2 4.283 2.1
Cancer 2499 3.129 1.6
Disease Target Count
Familial cancer of breast 12

Expression

  Differential Expression (9)

Disease log2 FC p
active ulcerative colitis 1.549 3.6e-02
astrocytic glioma -1.100 4.8e-02
medulloblastoma -1.100 2.3e-03
medulloblastoma, large-cell -2.500 2.3e-05
nephrosclerosis -1.027 3.4e-02
osteosarcoma -2.068 1.2e-09
ovarian cancer 2.000 4.4e-08
pancreatic ductal adenocarcinoma liver m... -2.697 3.3e-03
Pilocytic astrocytoma -1.100 2.8e-05

PDB (64)

Gene RIF (48)

AA Sequence

MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTLSNPEVFNYGV      1 - 70
ETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIPGFYDSGLLQG     71 - 140
KLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFCGFKVLAPQISFAPEIASEEERKGMVAAWSQ    141 - 210
RLQTIWKEEPIPCTAHWHFGQ                                                     211 - 231
//

Text Mined References (68)

PMID Year Title