Property Summary

Ligand Count 142
NCBI Gene PubMed Count 64
PubMed Score 86.03
PubTator Score 122.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Marburg hemorrhagic fever 2 4.283 2.1
Cancer 2499 3.129 1.6
Disease Target Count
Familial cancer of breast 12

Expression

  Differential Expression (9)

Disease log2 FC p
active ulcerative colitis 1.549 3.6e-02
astrocytic glioma -1.100 4.8e-02
medulloblastoma -1.100 2.3e-03
medulloblastoma, large-cell -2.500 2.3e-05
nephrosclerosis -1.027 3.4e-02
osteosarcoma -2.068 1.2e-09
ovarian cancer 2.000 4.4e-08
pancreatic ductal adenocarcinoma liver m... -2.697 3.3e-03
Pilocytic astrocytoma -1.100 2.8e-05

Synonym

Accession P16083 B2R492 Q5TD04
Symbols QR2
DHQV
DIA6
NMOR2

Gene

PDB

1QR2   1SG0   1XI2   1ZX1   2BZS   2QMY   2QMZ   2QR2   2QWX   2QX4   2QX6   2QX8   2QX9   3FW1   3G5M   3GAM   3NFR   3NHF   3NHJ   3NHK   3NHL   3NHP   3NHR   3NHS   3NHU   3NHW   3NHY   3O2N   3O73   3OVM   3OWH   3OWX   3OX1   3OX2   3OX3   3TE7   3TEM   3TZB   3UXE   3UXH   4FGJ   4FGK   4FGL   4GQI   4GR9   4QOD   4QOE   4QOF   4QOG   4QOH   4QOI   4QOJ   4U7F   4U7G   4U7H   4XDG   4XDH   4ZVK   4ZVL   4ZVM   4ZVN   5BUC   5LBT   5LBU  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (48)

AA Sequence

MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTLSNPEVFNYGV      1 - 70
ETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIPGFYDSGLLQG     71 - 140
KLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFCGFKVLAPQISFAPEIASEEERKGMVAAWSQ    141 - 210
RLQTIWKEEPIPCTAHWHFGQ                                                     211 - 231
//

Text Mined References (68)

PMID Year Title