Property Summary

NCBI Gene PubMed Count 61
Grant Count 61
R01 Count 53
Funding $4,524,819.1
PubMed Score 78.32
PubTator Score 122.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
nephrosclerosis -1.027 0.034
astrocytic glioma -1.100 0.048
osteosarcoma -2.068 0.000
sonic hedgehog group medulloblastoma -1.500 0.004
medulloblastoma, large-cell -2.500 0.000
pancreatic ductal adenocarcinoma liver m... -2.697 0.003
ulcerative colitis 1.900 0.002
pilocytic astrocytoma -1.100 0.000
ovarian cancer 2.000 0.000

Synonym

Accession P16083 B2R492 Q5TD04
Symbols QR2
DHQV
DIA6
NMOR2

Gene

PDB

1QR2   1SG0   1XI2   1ZX1   2BZS   2QMY   2QMZ   2QR2   2QWX   2QX4   2QX6   2QX8   2QX9   3FW1   3G5M   3GAM   3NFR   3NHF   3NHJ   3NHK   3NHL   3NHP   3NHR   3NHS   3NHU   3NHW   3NHY   3O2N   3O73   3OVM   3OWH   3OWX   3OX1   3OX2   3OX3   3TE7   3TEM   3TZB   3UXE   3UXH   4FGJ   4FGK   4FGL   4GQI   4GR9   4QOD   4QOE   4QOF   4QOG   4QOH   4QOI   4QOJ   4U7F   4U7G   4U7H   4XDG   4XDH   4ZVK   4ZVL   4ZVM   4ZVN   5BUC   5LBT   5LBU  

Gene RIF (47)

PMID Text
26609153 In patients with Alzheimer's disease, QR2 is overexpressed in the insular cotex.
24631540 NQO2-L47 is less stable towards proteolytic digestion and thermal denaturation than NQO2-F47.
23471972 This first structure of a reduced quinone reductase shows that reduction of the FAD cofactor and binding of a specific inhibitor lead to global changes in NQO2 structure and is consistent with a functional role for NQO2 as a flavin redox switch.
23054000 Diplotypes of NQO1 (exon 4 and 6), C-T (OR = 1.56, Pc = 0.007) and T-T (OR = 0.011, Pc = 3.86) was associated with an increased risk for prostate cancer (PCa). NQO2 and MTHFR did not show any risk with PCa.
22770696 NQO1 609C>T and NQO2 -3423G>A polymorphisms do not seem to play any significant role in susceptibility or prognosis of EC in north Indian population.
22266466 results indicate a role of NQO2 in the control of AKT/GSK-3beta/cyclin D1 and highlight the involvement of NQO2 in degradation of cyclin D1, as part of mechanism of chemoprevention by resveratrol
21946896 both NQO1 and NQO2 modulate the efficacy of AC therapy and that NQO2 is associated with tamoxifen toxicity.
21803122 results suggest that the increase in hippocampal QR2 might be a cause of AD or might promote the progression of AD by causing an increase in the toxic quinone levels and consequent loss of cognitive function.
21718050 Selective inhibition of NQO2 over NQO1 can be attributed to the bulky aminoalkylamino substituent at the 5-position, which blocks entrance of the indolequinones into the NQO1 active site.
21555518 NQO2 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
More...

AA Sequence

MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTLSNPEVFNYGV      1 - 70
ETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIPGFYDSGLLQG     71 - 140
KLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFCGFKVLAPQISFAPEIASEEERKGMVAAWSQ    141 - 210
RLQTIWKEEPIPCTAHWHFGQ                                                     211 - 231
//

Text Mined References (65)

PMID Year Title
26609153 2015 Expression of Quinone Reductase-2 in the Cortex Is a Muscarinic Acetylcholine Receptor-Dependent Memory Consolidation Constraint.
25416956 2014 A proteome-scale map of the human interactome network.
24631540 2014 The two common polymorphic forms of human NRH-quinone oxidoreductase 2 (NQO2) have different biochemical properties.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23471972 2013 Chloroquine binding reveals flavin redox switch function of quinone reductase 2.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23054000 2012 Genetic variants in metabolizing genes NQO1, NQO2, MTHFR and risk of prostate cancer: a study from North India.
22770696 2012 Null association of NQO1 609C>T and NQO2 -3423G>A polymorphisms with susceptibility and prognosis of Esophageal cancer in north Indian population and meta-analysis.
22266466 2012 Control of stability of cyclin D1 by quinone reductase 2 in CWR22Rv1 prostate cancer cells.
More...