Property Summary

NCBI Gene PubMed Count 904
PubMed Score 6460.00
PubTator Score 3956.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
Duchenne muscular dystrophy 602 8.53777831235787E-11
juvenile dermatomyositis 1189 1.62278538275328E-10
ulcerative colitis 2087 9.51105688671461E-10
malignant mesothelioma 3163 1.11155781062925E-7
pilocytic astrocytoma 3086 1.20691545775157E-6
pediatric high grade glioma 2712 2.60916249036226E-6
lung cancer 4473 5.58041624172194E-6
limb girdle muscular dystrophy 2I 56 6.93024647326634E-6
glioblastoma 5572 7.93019698181953E-6
ovarian cancer 8492 1.41879277545124E-5
tuberculosis 1563 4.43560094833866E-5
uncontrolled asthma 67 9.98263785223769E-5
psoriasis 6685 2.00420737817921E-4
fascioscapulohumeral muscular dystrophy 100 2.55069007373512E-4
colon cancer 1475 4.22788152585846E-4
Becker muscular dystrophy 187 0.00148045111948521
pituitary cancer 1972 0.0017593317157664
Waldenstrons macroglobulinemia 765 0.00217437787742478
acute quadriplegic myopathy 1157 0.00219646288931156
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00227462812335835
active Crohn's disease 918 0.00466951901879984
ependymoma 2514 0.00583619403140157
subependymal giant cell astrocytoma 2287 0.00602177896431418
astrocytic glioma 2241 0.00712157677845986
COPD 116 0.00962508249033009
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0131648599973774
nephrosclerosis 329 0.0161497162299514
gastric carcinoma 832 0.0166722079340126
non diabetic and post-ischemic heart failure 200 0.0180466945114942
Down syndrome 548 0.0205400022169857
ductal carcinoma in situ 1745 0.0227827732060021
Rheumatoid Arthritis 1171 0.0229067955943552
non primary Sjogren syndrome sicca 840 0.0247277098550928
diabetes mellitus 1663 0.0255239360639344
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0267556781273848
invasive ductal carcinoma 2950 0.0298047617115521
oligodendroglioma 2849 0.0354149567663847
dermatomyositis 967 0.0378212078997176
adrenocortical carcinoma 1427 0.0398036850468889
atypical teratoid / rhabdoid tumor 4369 0.0469935538329011

Expression

Gene

PDB

1POZ   1UUH   2I83   4PZ3   4PZ4  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Xenopus EggNOG Inparanoid

Gene RIF (815)

PMID Text
26974151 lncRNA-uc002kmd.1 regulates CD44 as a molecular decoy for miR211-3p.
26897523 findings suggested that HIV-1 gp41-I90 ectodomain can enhance the transmigration of THP-1 through Cn-infected BBB, which may be mediated by CD44.
26823744 Maximal expression of CD44v6 in adenoma plays crucial role in colorectal carcinogenesis, while loss of CD44v6 expression enhances progression of metastasis. CD44v6 down-regulation is an independent prognostic factor for worse disease-specific survival.
26762850 High CD44 expression contributes to the development of carboplatin resistance in advanced serous epithelial ovarian cancer.
26708679 CD44 promotes chemoresistance in T-ALL by increased drug efflux.
26687806 the prevalence of ALDH1A3(+)/CD44(+) tumor cells in breast cancer is significantly associated with worse prognostic factors and favors a poor prognosis
26647656 we present evidence that CD44v3 immunoexpression and CD44v3+/CD24- immunophenotypes could give prognostic information associated with unfavorable clinical outcomes.
26639196 Suggest that CD44 is involved in the progression of precancerous gastric lesions in patients infected with Helicobacter pylori.
26621455 the gain of CD44v6 expression in premalignant and malignant colonic lesions suggests that CD44v6 may be functionally involved in the adenoma-to-carcinoma progression
26617909 CD44 polymorphisms are associated with chronic HBV infection as the risk factors
More...

AA Sequence

MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKAL      1 - 70
SIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFD     71 - 140
GPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSP    141 - 210
WITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNE    211 - 280
ENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRN    281 - 350
GTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDS    351 - 420
HSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTG    421 - 490
LVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGY    491 - 560
TSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGS    561 - 630
QEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLN    631 - 700
GEASKSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV                                701 - 742
//

Text Mined References (922)

PMID Year Title
26974151 2016 Long Non-Coding RNA ucoo2kmd.1 Regulates CD44-Dependent Cell Growth by Competing for miR-211-3p in Colorectal Cancer.
26897523 2016 CD44-mediated monocyte transmigration across Cryptococcus neoformans-infected brain microvascular endothelial cells is enhanced by HIV-1 gp41-I90 ectodomain.
26823744 2015 CD44v6 down-regulation is an independent prognostic factor for poor outcome of colorectal carcinoma.
26762850 2016 Clinical relevance of CD44 surface expression in advanced stage serous epithelial ovarian cancer: a prospective study.
26708679 2016 CD44 promotes chemoresistance in T-ALL by increased drug efflux.
26687806 2016 ALDH(+)/CD44(+) cells in breast cancer are associated with worse prognosis and poor clinical outcome.
26647656 2016 CD44v3+/CD24- cells possess cancer stem cell-like properties in human oral squamous cell carcinoma.
26639196 2016 The homing receptor CD44 is involved in the progression of precancerous gastric lesions in patients infected with Helicobacter pylori and in development of mucous metaplasia in mice.
26621455 2016 The expression of CD44v6 in colon: from normal to malignant.
26617909 2015 Genetic association between CD44 polymorphisms and chronic hepatitis B virus infection in a Chinese Han population.
More...