Property Summary

NCBI Gene PubMed Count 1,007
PubMed Score 6832.72
PubTator Score 3956.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
Duchenne muscular dystrophy 601 8.5e-11
juvenile dermatomyositis 1187 1.6e-10
Astrocytoma, Pilocytic 3081 1.5e-07
malignant mesothelioma 3232 1.6e-07
tuberculosis 2010 4.5e-06
limb girdle muscular dystrophy 2A 213 6.8e-06
uncontrolled asthma 56 1.0e-04
psoriasis 6694 2.0e-04
fascioscapulohumeral muscular dystrophy 100 2.6e-04
glioblastoma 5792 3.0e-04
lung cancer 4740 3.4e-04
colon cancer 1478 4.2e-04
Becker muscular dystrophy 191 1.5e-03
Waldenstrons macroglobulinemia 765 2.2e-03
acute quadriplegic myopathy 1158 2.2e-03
autosomal dominant Emery-Dreifuss muscular dystrophy 510 2.3e-03
astrocytic glioma 2597 2.4e-03
adult high grade glioma 3801 2.5e-03
pancreatic ductal adenocarcinoma liver metastasis 1962 4.5e-03
active Crohn's disease 922 4.7e-03
pituitary cancer 1972 6.9e-03
ependymoma 4679 8.3e-03
COPD 118 9.6e-03
ovarian cancer 8520 1.4e-02
nephrosclerosis 333 1.6e-02
non diabetic and post-ischemic heart failure 200 1.8e-02
gastric carcinoma 807 2.0e-02
Down syndrome 499 2.1e-02
active ulcerative colitis 764 2.1e-02
ductal carcinoma in situ 1745 2.3e-02
Rheumatoid arthritis 1191 2.3e-02
non primary Sjogren syndrome sicca 891 2.5e-02
diabetes mellitus 1728 2.6e-02
intraductal papillary-mucinous adenoma (IPMA) 2955 2.7e-02
oligodendroglioma 2850 2.8e-02
invasive ductal carcinoma 2951 3.0e-02
dermatomyositis 966 3.8e-02
adrenocortical carcinoma 1428 4.0e-02
atypical teratoid / rhabdoid tumor 5112 4.7e-02
subependymal giant cell astrocytoma 2287 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (40)

Disease log2 FC p
active Crohn's disease 1.377 4.7e-03
active ulcerative colitis 2.133 2.1e-02
acute quadriplegic myopathy 1.285 2.2e-03
adrenocortical carcinoma -1.305 4.0e-02
adult high grade glioma 1.600 2.5e-03
astrocytic glioma 1.400 2.4e-03
Astrocytoma, Pilocytic 2.300 1.5e-07
atypical teratoid / rhabdoid tumor 1.500 4.7e-02
autosomal dominant Emery-Dreifuss muscul... 2.025 2.3e-03
Becker muscular dystrophy 1.727 1.5e-03
colon cancer 1.100 4.2e-04
COPD -1.100 9.6e-03
dermatomyositis 1.100 3.8e-02
diabetes mellitus -1.100 2.6e-02
Down syndrome 1.900 2.1e-02
Duchenne muscular dystrophy 2.609 8.5e-11
ductal carcinoma in situ 1.200 2.3e-02
ependymoma 2.600 8.3e-03
fascioscapulohumeral muscular dystrophy 1.454 2.6e-04
gastric carcinoma 1.200 2.0e-02
glioblastoma 1.800 3.0e-04
intraductal papillary-mucinous adenoma (... -1.200 2.7e-02
invasive ductal carcinoma 1.074 3.0e-02
juvenile dermatomyositis 1.945 1.6e-10
limb girdle muscular dystrophy 2A 1.897 6.8e-06
lung cancer -2.000 3.4e-04
malignant mesothelioma -1.700 1.6e-07
nephrosclerosis 1.182 1.6e-02
non diabetic and post-ischemic heart fai... -1.400 1.8e-02
non primary Sjogren syndrome sicca -1.100 2.5e-02
oligodendroglioma 1.800 2.8e-02
ovarian cancer -1.100 1.4e-02
pancreatic ductal adenocarcinoma liver m... 1.160 4.5e-03
pituitary cancer -1.200 6.9e-03
psoriasis -1.300 2.0e-04
Rheumatoid arthritis 1.900 2.3e-02
subependymal giant cell astrocytoma 1.120 4.8e-02
tuberculosis -1.400 4.5e-06
uncontrolled asthma 1.400 1.0e-04
Waldenstrons macroglobulinemia 2.302 2.2e-03

Gene RIF (919)

AA Sequence

MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKAL      1 - 70
SIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFD     71 - 140
GPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSP    141 - 210
WITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNE    211 - 280
ENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRN    281 - 350
GTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDS    351 - 420
HSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTG    421 - 490
LVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGY    491 - 560
TSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGS    561 - 630
QEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLN    631 - 700
GEASKSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV                                701 - 742
//

Text Mined References (1025)

PMID Year Title