Property Summary

NCBI Gene PubMed Count 76
Grant Count 124
R01 Count 103
Funding $12,337,285.98
PubMed Score 394.79
PubTator Score 185.48

Knowledge Summary

Patent (51,125)

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.229 0.008
non-small cell lung cancer -2.190 0.000
lung cancer -2.400 0.000
breast carcinoma -1.800 0.000
fibroadenoma -1.800 0.035
lung adenocarcinoma -2.000 0.000
adult high grade glioma -1.100 0.001
non primary Sjogren syndrome sicca 1.200 0.015
lung carcinoma -1.200 0.000
ductal carcinoma in situ -2.400 0.000
invasive ductal carcinoma -2.800 0.001
psoriasis -1.100 0.000

Synonym

Accession P16066 B0ZBF0 Q5SR08 Q6P4Q3
Symbols ANPa
NPRA
ANPRA
GUC2A
GUCY2A

Gene

PANTHER Protein Class (3)

Gene RIF (61)

PMID Text
26374856 After ligand binding, NPRA is rapidly internalized and trafficked from the cell surface into endosomes, Res and lysosomes, with concurrent generation of intracellular cyclic GMP in HEK-293 cells.
26253614 Data suggest up-regulation of NPRA in skeletal muscle (SM) correlates with whole-body insulin sensitivity; NPRA is down-regulated in SM in obese subjects compared to normal controls; NPRA in SM is up-regulated in response to diet-induced weight loss.
25955817 In this review we highlight the mechanisms by which NPR-A affects signaling pathways involved in inflammation and cancer, and we discuss its potential as a novel target in inflammation, cancer, and cancer-related inflammation
25631869 NPRA was detected in E11.5 cardiac progenitor cells.
25117468 Cardiac fibrosis and the endogenous natriuretic peptide system were evaluated in end-stage heart failure to assess the anti-fibrotic actions of the dual GC-A/-B activator.
24885858 High NPR1 expression is associated with esophageal squamous cell carcinomas.
24699414 Molecular dynamics analysis indicated decreases in the values of Van der Waals, electrostatic energy and potential energy of NPRB/Vasonatrin peptide compared to NPRA/Vasonatrin peptide.
23186809 ACNP stimulated both human natriuretic peptide receptors (NPRs), NPRA and NPRB, as potent as their native ligands in receptor transfected cells.
22949736 Guanylyl cyclases A and B are asymmetric dimers that are allosterically activated by ATP binding to the catalytic domain.
22133375 human ventricular cardiomyocytes express low levels of GC-A and GC-A in cardiomyocytes from failing human hearts is refractory to ANP stimulation.
More...

AA Sequence

MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHAGNLTVAVVLPLANTSYPWSWARVGPAVELALAQVKARP      1 - 70
DLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAVFLGPGCVYAAAPVGRFTAHWRVPLLTAG     71 - 140
APALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWERQALMLYAYRPGDEEHCFFLVEGLFMRVRDR    141 - 210
LNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSL    211 - 280
QGGQGPAPRRPWERGDGQDVSARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIP    281 - 350
ASFHDGLLLYIQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAF    351 - 420
RVVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGSLSLLGILIVS    421 - 490
FFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNYGSLLTTEGQFQVFAKTAYYK    491 - 560
GNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESIT    561 - 630
LDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTVYAKKL    631 - 700
WTAPELLRMASPPVRGSQAGDVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQ    701 - 770
SHLEELGLLMQRCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLE    771 - 840
EKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDA    841 - 910
VIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPV    911 - 980
CAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYW    981 - 1050
LLGERGSSTRG                                                              1051 - 1061
//

Text Mined References (78)

PMID Year Title
26374856 2015 Subcellular trafficking of guanylyl cyclase/natriuretic peptide receptor-A with concurrent generation of intracellular cGMP.
26253614 2015 Defective Natriuretic Peptide Receptor Signaling in Skeletal Muscle Links Obesity to Type 2 Diabetes.
25955817 2015 NPR-A: A Therapeutic Target in Inflammation and Cancer.
25631869 2015 Atrial natriuretic peptide inhibits cell cycle activity of embryonic cardiac progenitor cells via its NPRA receptor signaling axis.
25117468 2014 Cardiac fibrosis in end-stage human heart failure and the cardiac natriuretic peptide guanylyl cyclase system: regulation and therapeutic implications.
24885858 2014 Expression of natriuretic peptide receptor-A in esophageal squamous cell carcinomas and the relationship with tumor invasion and migration.
24699414 2014 Vasonatrin peptide stimulates both of the natriuretic peptide receptors, NPRA and NPRB.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23186809 2013 Chimeric natriuretic peptide ACNP stimulates both natriuretic peptide receptors, the NPRA and NPRB.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...