Property Summary

Ligand Count 3
NCBI Gene PubMed Count 78
PubMed Score 409.96
PubTator Score 185.48

Knowledge Summary

Patent (51,125)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.100 1.0e-03
breast carcinoma -1.800 2.7e-04
ductal carcinoma in situ -1.400 4.8e-04
fibroadenoma -1.800 3.5e-02
invasive ductal carcinoma -1.500 4.8e-03
lung adenocarcinoma -1.300 6.6e-13
lung cancer -1.200 6.5e-03
lung carcinoma -1.200 8.8e-10
non primary Sjogren syndrome sicca 1.200 1.5e-02
non-small cell lung cancer -2.190 1.1e-35
osteosarcoma -1.229 7.7e-03
psoriasis -1.100 2.0e-32

 CSPA Cell Line (1)

Gene RIF (63)

AA Sequence

MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHAGNLTVAVVLPLANTSYPWSWARVGPAVELALAQVKARP      1 - 70
DLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAVFLGPGCVYAAAPVGRFTAHWRVPLLTAG     71 - 140
APALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWERQALMLYAYRPGDEEHCFFLVEGLFMRVRDR    141 - 210
LNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSL    211 - 280
QGGQGPAPRRPWERGDGQDVSARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIP    281 - 350
ASFHDGLLLYIQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAF    351 - 420
RVVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGSLSLLGILIVS    421 - 490
FFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNYGSLLTTEGQFQVFAKTAYYK    491 - 560
GNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESIT    561 - 630
LDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTVYAKKL    631 - 700
WTAPELLRMASPPVRGSQAGDVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQ    701 - 770
SHLEELGLLMQRCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLE    771 - 840
EKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDA    841 - 910
VIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPV    911 - 980
CAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYW    981 - 1050
LLGERGSSTRG                                                              1051 - 1061
//

Text Mined References (80)

PMID Year Title