Property Summary

NCBI Gene PubMed Count 169
Grant Count 206
R01 Count 118
Funding $25,768,720
PubMed Score 256.00
PubTator Score 537.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
uncontrolled asthma 1.100 0.006
osteosarcoma -1.226 0.007
ovarian cancer -1.900 0.000

Synonym

Accession P16050 A8K2P4 B7ZA11 Q8N6R7 Q99657 15-LOX
Symbols 12-LOX
15LOX-1
15-LOX-1

Gene

PANTHER Protein Class (2)

PDB

2ABT  

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
887 confirmatory 1054 / 3789 / 69447 qHTS Assay for Inhibitors of 15-hLO (15-human lipoxygenase)
2155 confirmatory 20 / 0 / 0 Cuvette-Based Assay fo Inhibitors of 15-hLO-1 (15-human lipoxygenase 1): Series 1 - Round 1
2157 confirmatory 12 / 15 / 27 Confirmation qHTS Assay for Inhibitors of 15-hLO (15-human lipoxygenase)
2169 summary 0 / 0 / 0 Probe Development Summary of Inhibitors of 15-hLO-1 (15-human lipoxygenase 1)
493219 confirmatory 0 / 0 / 60 Inhibitors of 12-hLO (12-human lipoxygenase): 15hLO-1 Cuvette-Based Activation Counterscreen Assay for 12hLO Followup Compounds
493220 confirmatory 45 / 2 / 13 Inhibitors of 12-hLO (12-human lipoxygenase): 15hLO-1 Cuvette-Based Inhibition Counterscreen Assay for 12hLO Followup Compounds

Gene RIF (151)

PMID Text
26871724 Hypoxia increase the production of ROS through the 15-Lipoxygenase/15-Hydroxyeicosatetraenoiccid pathway.
26646740 The molecular origin of substrate specificity of 15-LOX-1 for linoleic acid in comparison with arachidonic acid has been analyzed.
26276392 limiting ALOX15 expression by AMPK may promote an anti-inflammatory phenotype of IL-4-stimulated human macrophages
26194111 The role of 15-LOX-1 in colitis and colitis-associated colorectal cancer
26067486 Significant associations with NSAID-exacerbated respiratory disease were identified for: ALOX15 homozygous genotype and PTGS-1 rs5789 A/A homozygous genotype
26036173 variation in inflammation related genes ALOX15 and IL6 was associated with bone microarchitecture and density in young adult women, but appears to be less important in the elderly
25708815 The 12/15-lipoxygenase as an emerging therapeutic target for Alzheimer's disease
25576922 Effect of 12/15-LOX on colorectal tumorigenesis in mouse models could be affected by tumor cell type (human or mouse), relative 12/15 LOX activity in tumor cells and stroma as well as the relative tumor 13-HODE and 12-HETE levels.
25549319 IGF-1 reduces lipid oxidation and foam cell formation via downregulation of 12/15-LOX to prevent atherosclerosis.
25105362 Loss of Alox15 altered expression of PTEN, PI3K/AKT, and the transcription factor ICSBP
More...

AA Sequence

MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHL      1 - 70
LKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYR     71 - 140
WGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCG    141 - 210
QSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSL    211 - 280
LDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSS    281 - 350
DFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST    351 - 420
GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVSLHYKTDVAVK    421 - 490
DDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCT    491 - 560
MRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREEL    561 - 630
AALDKEIEIRNAKLDMPYEYLRPSVVENSVAI                                          631 - 662
//

Text Mined References (172)

PMID Year Title
26871724 2016 Key Role of ROS in the Process of 15-Lipoxygenase/15-Hydroxyeicosatetraenoiccid-Induced Pulmonary Vascular Remodeling in Hypoxia Pulmonary Hypertension.
26646740 2016 How Can Linoleic Acid Be the Preferential Substrate of the Enzyme 15-Lipoxygenase-1? A QM/MM Approach.
26276392 2015 AMP-activated protein kinase suppresses arachidonate 15-lipoxygenase expression in interleukin 4-polarized human macrophages.
26194111 2015 The role of 15-LOX-1 in colitis and colitis-associated colorectal cancer.
26067486 2015 Genetic variants in arachidonic acid pathway genes associated with NSAID-exacerbated respiratory disease.
26036173 2015 Polymorphisms in inflammation associated genes ALOX15 and IL-6 are associated with bone properties in young women and fracture in elderly.
25708815 2015 The 12/15-lipoxygenase as an emerging therapeutic target for Alzheimer's disease.
25576922 2015 12/15 Lipoxygenase regulation of colorectal tumorigenesis is determined by the relative tumor levels of its metabolite 12-HETE and 13-HODE in animal models.
25549319 2015 Insulin-like growth factor I reduces lipid oxidation and foam cell formation via downregulation of 12/15-lipoxygenase.
25105362 2014 Arachidonate 15-lipoxygenase is required for chronic myeloid leukemia stem cell survival.
More...