Property Summary

Ligand Count 154
NCBI Gene PubMed Count 180
PubMed Score 277.57
PubTator Score 537.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Atherosclerosis 291 3.533 1.8
Esophageal Neoplasms 69 0.0 0.0
Hypertension 396 0.0 0.0
Disease Target Count
Hypertensive disease 292
Disease Target Count
Actinic keratosis 21
Disease Target Count P-value
ovarian cancer 8520 4.3e-10
uncontrolled asthma 56 6.0e-03
osteosarcoma 7950 7.2e-03
Disease Target Count Z-score Confidence
Cancer 2499 3.712 1.9
Asthma 385 3.074 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.226 7.2e-03
ovarian cancer -1.900 4.3e-10
uncontrolled asthma 1.100 6.0e-03

Protein-protein Interaction (1)

Gene RIF (161)

AA Sequence

MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHL      1 - 70
LKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYR     71 - 140
WGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCG    141 - 210
QSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSL    211 - 280
LDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSS    281 - 350
DFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST    351 - 420
GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVSLHYKTDVAVK    421 - 490
DDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCT    491 - 560
MRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREEL    561 - 630
AALDKEIEIRNAKLDMPYEYLRPSVVENSVAI                                          631 - 662
//

Text Mined References (183)

PMID Year Title