Property Summary

NCBI Gene PubMed Count 358
Grant Count 181
R01 Count 133
Funding $12,742,298.42
PubMed Score 1043.85
PubTator Score 954.68

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession P16035 Q16121 Q93006 Q9UDF7
Symbols DDC8
CSC-21K

Gene

PDB

4ILW   1GXD   1BR9   2TMP  

Gene RIF (334)

PMID Text
26978018 The invasive potential of CSCC has been established to be substantially influenced by the increased expression of MMP-9 and uPA and by the decreased expression of TIMP-2, as well as to a lesser extent by a change in MMP-2 expression
26823777 Pathogenesis and progression of nasal polyps is closely related with elevated MMP-9 and suppressed TIMP-2 expression
26606754 This study shows that urinary [TIMP-2]*[IGFBP7] has a good diagnostic performance in predicting adverse outcomes in neonatal and pediatric AKI of heterogeneous etiology.
26556867 our results demonstrate that TIMP-2 stimulates lung adenocarcinoma cell proliferation
26551785 showed a significant association between the variants of MMP-2 and TIMP-2 promoters and spontaneous intracerebral hemorrhage
26539028 TIMP1, TIMP2, and TIMP4 are increased in aqueous humor from primary open angle glaucoma patients.
26331622 TIMP-2 interaction with MT1-MMP provides tumor cells with either pro- or anti-apoptotic signaling depending on the extracellular environment and apoptotic stimulus.
26329758 TIMP2 is elevated in patients with non-alcoholic fatty liver disease.
26278569 MiR-761 directly targeted ING4 and TIMP2.
26268417 The expression levels MMP-9, TIMP-1, and TIMP-2 in both marrow plasma and culture supernatants were significantly higher in MM patients than controls.
More...

AA Sequence

MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQ      1 - 70
YEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQ     71 - 140
KKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPP    141 - 210
KQEFLDIEDP                                                                211 - 220
//

Text Mined References (360)

PMID Year Title
26978018 [Matrix metalloproteinases 2 and 9, their endogenous regulators, and angiotensin-converting enzyme in cervical squamous cell carcinoma].
26823777 2015 Expression of MMP-9/TIMP-2 in nasal polyps and its functional implications.
26606754 2015 Urinary Tissue Inhibitor of Metalloproteinase-2 (TIMP-2) • Insulin-Like Growth Factor-Binding Protein 7 (IGFBP7) Predicts Adverse Outcome in Pediatric Acute Kidney Injury.
26556867 2015 Growth-stimulatory activity of TIMP-2 is mediated through c-Src activation followed by activation of FAK, PI3-kinase/AKT, and ERK1/2 independent of MMP inhibition in lung adenocarcinoma cells.
26551785 2015 Polymorphisms in the Promoters of the MMP-2 and TIMP-2 Genes Are Associated with Spontaneous Deep Intracerebral Hemorrhage in the Taiwan Population.
26539028 2015 TIMP1, TIMP2, and TIMP4 are increased in aqueous humor from primary open angle glaucoma patients.
26331622 2015 TIMP-2 Interaction with MT1-MMP Activates the AKT Pathway and Protects Tumor Cells from Apoptosis.
26329758 2015 Tissue Inhibitors of Metalloproteinase-1 and 2 and Obesity Related Non-Alcoholic Fatty Liver Disease: Is There a Relationship.
26278569 2015 MiR-761 Promotes Progression and Metastasis of Non-Small Cell Lung Cancer by Targeting ING4 and TIMP2.
26268417 2016 Increased expression of metalloproteinase-2 and -9 (MMP-2, MMP-9), tissue inhibitor of metalloproteinase-1 and -2 (TIMP-1, TIMP-2), and EMMPRIN (CD147) in multiple myeloma.
More...