Property Summary

NCBI Gene PubMed Count 358
PubMed Score 1043.85
PubTator Score 954.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Connective tissue disease 59 0.0 1.0

Expression

Protein-protein Interaction (4)

Gene RIF (334)

PMID Text
26978018 The invasive potential of CSCC has been established to be substantially influenced by the increased expression of MMP-9 and uPA and by the decreased expression of TIMP-2, as well as to a lesser extent by a change in MMP-2 expression
26823777 Pathogenesis and progression of nasal polyps is closely related with elevated MMP-9 and suppressed TIMP-2 expression
26606754 This study shows that urinary [TIMP-2]*[IGFBP7] has a good diagnostic performance in predicting adverse outcomes in neonatal and pediatric AKI of heterogeneous etiology.
26556867 our results demonstrate that TIMP-2 stimulates lung adenocarcinoma cell proliferation
26551785 showed a significant association between the variants of MMP-2 and TIMP-2 promoters and spontaneous intracerebral hemorrhage
26539028 TIMP1, TIMP2, and TIMP4 are increased in aqueous humor from primary open angle glaucoma patients.
26331622 TIMP-2 interaction with MT1-MMP provides tumor cells with either pro- or anti-apoptotic signaling depending on the extracellular environment and apoptotic stimulus.
26329758 TIMP2 is elevated in patients with non-alcoholic fatty liver disease.
26278569 MiR-761 directly targeted ING4 and TIMP2.
26268417 The expression levels MMP-9, TIMP-1, and TIMP-2 in both marrow plasma and culture supernatants were significantly higher in MM patients than controls.
26191221 Suggest that miR-221 plays an oncogenic role in renal cancer cell proliferation, migration and invasion by directly inhibiting the tumor suppressor TIMP2.
26148591 TIMP-2 G-418C polymorphism may not influence the susceptibility of total cancer in overall population, but it was associated with cancer risk among Caucasian population.
26130791 TIMP2 -418 C allele is associated with susceptibility for varicose vein formation and individuals with GG genotype may have a lower risk for varicose vein formation.
26071077 TIMP-2 may be a marker for both invasion and recurrence of invasive prolactinomas
25839957 Tissue inhibitor of metalloproteinase 2 inhibits activation of the beta-catenin signaling in melanoma cells.
25826490 For gingiva samples from chronic periodontitis patients treated with antibiotics, MMP-2 positive reaction was restricted to deep epithelial layers and few cells of the connective tissue. No significant difference was observed for TIMP-2 expression.
25771900 There was no association between the expression of metallopeptidase-2 or tissue inhibitor of metalloprotease 2 and death or progression
25731730 Subsequent investigations revealed that TIMP2 is a direct target of miR-221/222, and overexpression of TIMP2 reduced the miR-221/222-mediated invasion, metastasis, and angiogenesis of glioma cells.
25656607 Our results suggest that the presence of the variant allele in the promoter of MMP-2 or TIMP-2 may be a protective factor for the development of breast cancer.
25579181 TIMP-2 gene methylation is associated with cervical precursor and invasive lesions.
25571919 Upregulation of EZH2, MMP2 and TIMP2 expression was correlated with metastasis of RCC to bone tissues ex vivo and in vitro.
25552509 Up-regulation of MT1-MMP and furin expression and low TIMP-2 expression make the main contribution to the invasiveness potential of squamous cell cervical carcinomas.
25539555 TIMP-2 -418 G/C polymorphism was shown to be involved in the pathogenesis of prostate cancer and a putative protective effect against it in a Turkish population.
25524453 Urinary TIMP-2 was able to detect severe acute kidney injury.
25436070 MMP-2, MMP-9, TIMP-1, and TIMP-2 may have important roles in the development and progression of MFH.
25412957 The MMP-2/TIMP-2 expression ratio has a higher prognostic value than the separate expressions of MMP-2 and TIMP-2.
25405519 we concluded that NCTD enhances TIMP2 antitumor and antiVM activities in gallbladder cancers through downregulating MMP2 and MT1MMP.
25300296 MMP-2, MMP-9, MMP-7 and TIMP-2 were upregulated in primary spontaneous pneumothorax lesions.
25280484 TIMP-2 -418 GC + CC and MMP-2 -1575GA/-1306CC genotypes could be genetic predisposing factors for moyamoya development.
25259564 The authors' results support the importance of MMPs and their tissue inhibitors in meningioma pathogenesis.
25189251 Single nucleotide polymorphisms in the human TIMP2 gene associated with hypertension in myocaridal infarction patients.
25153995 Our findings indicate that overexpression of MMP-9 and TIMPs in blood mononuclear cells and elevated depressive symptoms represent two unrelated phenomena after myocardial infarction.
25136829 The TIMP2 -418 G>C polymorphism may not be involved in predisposing risk factor for cancer.
25128867 No evidence was found for any associations between the TIMP-1,-2,-3, or -4 gene single nucleotide polymorphisms with unexplained recurrent spontaneous abortions in this Han Chinese Han population.
25060386 TIMP-2 functions in a contextual fashion such that the effect on cardiac fibroblasts depends on the tissue microenvironment.
24819588 Inhibition of TIMP activity showed that TIMP-1 and TIMP-2 together were largely responsible for the reduction of migration and invasion by MSCs.
24800696 TIMP-2 occurred mainly in patients over 50 years old.
24799419 new evidence that promoter polymorphisms in TIMP2 are functional and may affect gene transcription with possible effects on craniofacial development leading to NSCL/P.
24710006 Experimental results show high abundance of affinity-enhancing mutations in TIMP2, with some point mutations producing more than ten-fold improvement in affinity to MMP14.
24680659 the imbalance between serum MMP-9 and TIMP-2 levels could have a role in disease progression in patients with mRCC under treatment with sunitinib
24675717 The decline in urinary TIMP-2 and IGFBP7 values was the strongest predictor for renal recovery following cardiac surgery.
24591757 Concomitant increase in the expression of both MMP-2 and TIMP-2 in oral leukoplakia suggests that the activation of MMP-2 is dependent on TIMP-2 acting as a cofactor.
24534323 This study investigated whether the -418 G/C gene polymorphism is associated with AAA in the Polish population.
24479343 Matrix metalloproteinases (MMP)--MMP-1,-2,-9 and its endogenous activity regulators in transformed by E7 oncogene HPV16 and HPV18 cervical carcinoma cell lines
24475101 The lack of mitral TIMP2 expression is associated with increases in cardiovascular death and heart failure following mitral valve surgery.
24444603 miR-106a has an oncogenic role in pancreatic tumorigenesis by promoting cancer cell proliferation, epithelial-mesenchymal transition and invasion by targeting tissue inhibitors of metalloproteinase 2 (TIMP-2).
24440352 TIMP2 is a direct downstream target for miR-106a
24427326 results suggest miR-19a is related with TIMP-2 pathway in laryngeal squamous cell carcinoma cells
24403492 Low serum TIMP2 expression is associated with early recurrence in cervical cancer.
24395652 MMP-2 and TIMP-2 might play a role in the process of colorectal cancer invasion and metastasis
24384769 TIMP-2 seems to be a predictor of gastric tumor progression, especially for nodal involvement, whereas serum MMP-2 might be useful as an independent prognostic factor of patients' survival.
24355694 Higher serum MMP-2 levels and MMP-2/TIMP-2 ratio could predict poor prognosis after TACE, suggesting prognostic role of these biomarkers in HCC.
24335752 Data indicate a consistent correlation between RECK, MT1MMP, and TIMP2 across different models of clinical samples and cell lines and suggest evidence of the potential use of this subset of genes as a gene signature for diagnosing melanoma.
24212294 Report no association between lower levels of circulating TIMP2 and risk of prevalent cardiovascular disease in a general population cohort over 40 years.
24210229 After medical abortion, prolonged bleeding was associated with increased levels of TIMP-2 in the decidua.
24202705 Depletion of NEDD9 impaired invasion of cancer cells through inactivation of membrane-bound matrix metalloproteinase MMP14 by excess TIMP2 on the cell surface.
24068394 MMP2/TIMP2 and MMP9/TIMP1 immunoreactivity was extremely heterogeneous within the analyzed group of secondary liver tumors.
24042342 We found that MMP-1/TIMP-1 and MMP-1/TIMP-2 complexes were suppressed and that MMP-2 activity was upregulated in keratinocytes expressing siTIMP-1 or siTIMP-2.
23973519 Urine marker-TIMP2 may predict urinary tract impairment in children with myelodysplasia. and may differentiate at risk patients with either renal scarring or high detrusor leak point pressure.
23855590 Data indicate that CAPN 7 promotes endometrial stromal cell (hESC) migration and invasion by increasing the activity of MMP-2 via an increased ratio of MMP-2 to TIMP-2.
23817219 human brain microvascular endothelial cells switch to a proinflammatory state by means of an enhanced production of MMP-2, attenuated release of TIMP-1, and unaffected production of TIMP-2
23793312 increased expression of tissue inhibitor (TIMP-2) is responsible for disturbed equilibrium of the metalloproteinase/tissue inhibitors system and as a consequence, for destabilization of atherosclerotic plaque and occurrence of the acute coronary syndrome
23791966 MMP2-1306C/T, but not TIMP2G-418C, gene variants are a risk factor for the development of retinal vein occlusion.
23769926 the influences of PDGFRB, MMP-3, and TIMP-2 on MMD may be unremarkable in Chinese Hans. There may be no prominent interaction among these five gene polymorphisms on the occurrence of MMD.
23708302 we analyzed MMP-1, MMP-9 and TIMP-2 expression levels in tumoral and non-tumoral compartments of prostate cancer specimens
23673111 The levels of MMP2, MMP9, TIMP1, and TIMP2 in the peripheral blood of patients with papillary thyroid carcinoma were significantly higher than those with benign thyroid disease and healthy volunteers.
23661104 TIMP2 levels are significantly increased in the plasma of metabolic syndrome patients.
23650722 the increase of MMP-1 and MMP-9 expression and low of TIMP-1 and TIMP-2 expression makes the main contribution to the destructive (invasive) potential of SCC.
23585206 Positive correlations of MMP1, TIMP1 and 2 with pancreatic tumor diameter (CP) were observed, and MMP2 with the duration of surgery and blood loss
23563628 TIMP-1 and TIMP-2 gene polymorphisms have roles in progression of liver fibrosis in patients with type C chronic liver disease
23536957 MMP2 (-1306C>T) and TIMP2 (-418 G>C) promoter variants are unlikely to have a major role in age-related macular degeneration risk susceptibility.
23491141 DNA sequence variation within the TIMP2 gene is a risk factor for Achilles tendon pathology in Caucasians.
23472970 Up-regulation of tissue inhibitor of metalloproteinase-2 promotes SHI-1 cell invasion in nude mice.
23427184 TIMP-2 plays an important role in tumor growth in the case of BeWo choriocarcinoma cells.
23415672 Aim of the present study was to analyze the expression-profile of IGF1, IGFBP3, sICAM1, sVCAM1, MMP2, MMP9, TIMP2, VEGFA, VEGFD, VEGFC and VEGFR1 in patients with high-risk cervical cancer.
23412981 There is no difference in the placental TIMP1 and TIMP2 levels in women delivering preterm and at term.
23388612 TIMP2 urinary levels are a significantly valid marker of cell cycle arrest induction in acute kidney injury.
23388475 Report TIMP2 activity in chronic pancreatitis and pancreatic adenocarcinoma.
23371049 Data indicate that TIMP-2 promotes an anti-tumoral transcriptional profile in lung cancer including upregulation of E-cadherin.
23369618 Data indicate that the expressions of genes PDCD5 and TIMP2 were consistent with their DNA methylation profiles.
23320481 elevated levels of matrix metalloproteinase 9 and matrix metalloproteinase 2/tissue inhibitor of matrix metalloproteinase-2 complex may play a role in spontaneous termination of pregnancy
23264224 The aim of the present study was to investigate the diagnostic significance of MMP-2 and TIMP-2 serum levels in esophageal cancer patients in relation to clinico-pathological features of cancer.
23205572 miR-200b enhances matrix metallopeptidase 2 (MMP2) activity by downregulating TIMP2 expression in endometrial adenocarcinoma HEC-1A cells
23195431 CD133 affects the invasive ability of HCT116 cells by regulating TIMP-2.
23038618 There was no association between the presence of rs8179090 and curve progression in adolescent idiopathic scoliosis in a 2117-person Japanese cohort.
22985578 There was no association of TIMP2 expression and poor uterine scar healing and early caesarean scar pregnancy.
22985025 gene polymorphism is associated with advanced-stage endometriosis in Korean women
22883459 MMP-2, MMP-9 and TIMP-2, TIMP-1 may play an important role in the development, progression, invasion and metastasis of non-melanoma skin cancer.
22880464 The greatest intensity of the reaction and the villous TIMP-2 expression was characteristic of the group with untreated Intrauterine growth restriction.
22820140 Roles for MMP-2 and TIMP-2 in both thyroid development and malignant transformation.
22730240 Analysis of gene-gene interaction suggests that MMP3 and TIMP2 may interactively contribute to a cleft phenotype
22685266 Altered expression of miR-200c may have a significant impact on the outcome of leiomyomas growth, maintenance of their mesenchymal and fibrotic characteristics, and possibly their associated symptoms.
22621753 This study suggests that genetic variants in MMP-2,7,9 and TIMP-2genes are associated with higher susceptibility of gallbladder cancer.
22551568 cysteine-rich angiogenic inducer 61 may promote trophoblast cell migration and invasion through upregulation of NUR77 protein leading to the increase of matrix metalloproteinase 2(MMP2) release and the downregulation of tissue inhibitor of MMP2 expression
22546345 Knockdown of GRP78 decreases ECM degradation, and downregulates the expression and activity of TIMP-2
22532131 The the roles of TIMP-2 in Esophageal cancer (EC) development, tumor progression and formation of metastases have been most extensively characterized and best recognized.
22512703 The level of MMP-2 activation was significantly elevated in tissues with Dupuytren's contracture. RT-PCR demonstrated significantly higher expression of MMP-2, TIMP-2, TGF-beta1, and DCN mRNA in the pathological tissues
22511598 This study supports the concept of TIMP-2 expression in the stromal compartment of ovarian cancer(OC) as a promising marker of prognosis and response to cisplatin- and paclitaxel-based chemotherapy in OC patients.
22438955 effect of HPV16 oncoproteins on the expression and activity of MMP-2, MMP-9, MT1-MMP, and their inhibitors TIMP-2 and RECK in cultures of keratinocytes
22427646 Data show that TIMP-1 inhibits the MMP-10 with a K(i) of 1.1 x 10(-9) M, and TIMP-2 inhibits the MMP-10 with a K(i) of 5.8 x 10(-9) M.
22374248 TIMP2 (-418) GC was found to be involved in progression of PCa but not in initiation
22302011 found increased plasma MMP-2 and TIMP-2 levels in end-stage kidney disease patients compared to controls , and hemodialysis decreased MMP-2 (but not TIMP-2) levels.
22272343 Results suggest that EZH2-mediated transcriptional repression of TIMP3 directly leads to activation of MMP-9.
22270451 Data show that positive immunoreaction for inhibitor of matrix metalloproteinase 2 (TIMP-2) correlated with favorable cancer-specific and overall survival.
22262409 In hepatocellular carcinoma miR-519d is up-regulated by p53 and DNA hypomethylation and targets CDKN1A/p21, PTEN, AKT3 and TIMP2.
22200690 Failed to demonstrate any prognostic relevance of TIMP2 levels in advanced epithelial ovarian neoplasms.
22200256 an increase in the immunodistribution of MMP-2 and -9 and TIMP-1 and -2 in lichen sclerous compared to normal vulvar skin was observed.
22169692 TIMP2 polymorphism is significantly related with occurrence and development of gastric cancer.
22122951 TIMP-2 levels are significantly higher in osteoarthritic knees with clinical effusion than in knees without effusion.
22110735 NDRG2 contributed to an increase in the ratio of matrix metalloproteinase 2 (MMP2) to tissue inhibitor of matrix metalloproteinase 2
22051851 During labor, TIMP2, TIMP1 and MMP-7 were significantly increased in cervicovaginal fluid.
22020421 tissue inhibitor of metalloproteinase-2 promoter gene polymorphisms are associated with non-Hodgkin's lymphoma.
21871510 TIMP-2 integrin-binding peptides retain anti-mitogenic activity in vascular endothelial growth factor A stimulated human microvascular endothelial cells.
21839835 The C-terminal domain of TIMP-2 inhibits cell surface activation of proMMP-2.
21786179 The aim of our study was to compare the immunohistochemical expression of TIMP1 and TIMP2 between an uncontrollably invasive phenomenon (cancer) and an "in situ" process (trophoblast invasion)
21715326 phage display was used to identify variants of human TIMP-2 that are selective inhibitors of human MMP-1
21620625 Serum levels of MMP-2/TIMP-2 were significantly higher in patients with matured arteriovenous fistulas vs levels in those that failed.
21526499 results suggest the greater importance of serum MMP-2 and TIMP-2 than of the classical tumor markers CEA and CA 19-9 in the diagnosis of gastric cancer
21478099 Results indicate the better usefulness of TIMP-2 than MMP-2 in the diagnosis of colorectal cancer, especially in combined use with classic tumor marker of CRC, e.g. carcinoembryonic antigen.
21463121 Findings show significant correlations between MMP-2, -9, and syndecan-1 and hemostatic parameters in hematologic malignancies, in contrast, the MMP inhibitors, TIMP1- and -2, were not correlated with any of the hemostatic parameters.
21462296 Polymorphisms in TIMP2 and WNT9B are novel loci predisposing to cleft palate.
21454617 analysis of interactions of the catalytic domain (cd) of MMP-1 with the inhibitory domains of TIMP-1 and TIMP-2 (N-TIMPs) and MMP-3cd with N-TIMP-2
21437624 Data indicate that the balance between MMPs and TIMPs in women with PCOS is altered, probably due to androgen excess found in these women.
21432777 differences in histological features between nasal polyposis and chronic rhinosinusitis might be related to the expression of MMP-1, MMP-2, MMP-8 and their tissue inhibitor-2
21427648 The levels of TIMP-2 were significantly elevated in patients with inguinal hernia and significantly reduced in patients with aortic aneurysm.
21421877 MMP2, TIPM2, and TIMP3 genes were not associated with high myopia in this Chinese sample and hence are unlikely to play a major role in the genetic susceptibility to high myopia.
21261731 Specific single-nucleotide polymorphism in TIMP2 and MMP2/9 appeared to be associated with tumorigenesis and biological behavior in colorectal cancer.
21254651 TIMP2 may play a critical role in assisting nasopharyngeal carcinoma cells to degrade basement membrane to invade surrounding tissues and to form metastatic colonies in lymph nodes.
21228746 The TIMP-2 gene is a disease-modifier gene of thoracic adolescent idiopathic scoliosis.
21195432 Polymorphisms in the promoter region of MMP-9 and TIMP-2 are associated with varicose veins in the Chinese population.
21148412 Hypoxia reduces TIMP-2 secretion from human primary monocytes and from monocyte-like cell lines by inhibiting TIMP-2 transcription through mechanisms that involve the transcription factor SP-1.
21086628 Expression of matrix metalloproteinases 2 and 9 and their tissue inhibitors 1 and 2 in papillary thyroid cancer: an association with the clinical, morphological and ultrastructural characteristics of a tumor
20948207 Observational study of gene-disease association. (HuGE Navigator)
20941509 Downregulation of TIMP-2 by 17beta-estradiol in male patients would not be articular cartilage protective.
20940305 insulin-like growth factor-1 receptor is a binding partner of Loop 6/TIMP
20889295 Short-term use of statins is not associated in reducing levels of TIMP 2 in areas of low and peak wall stress in patients with abdominal aortic aneurysms.
20730428 Observational study of gene-disease association. (HuGE Navigator)
20718757 Findings provide evidence that one of the mechanisms of the increase in angiogenesis in diffuse-type gastric carcinoma is the downregulation of the anti-angiogenic protein TIMP2.
20707923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20694560 Observational study of gene-disease association. (HuGE Navigator)
20685029 An increase in MMP-2 mRNA and a decrease in TIMP-2 mRNA expression in uterosacral ligament are related to uterine prolapse in women without urinary incontinence.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20672350 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20627004 The SNP-418G/C in the promoter region of TIMP-2 gene may be associated with abnormal growth pattern and curve progression of thoracic adolescent idiopathic thoracic scoliosis.
20627004 Observational study of gene-disease association. (HuGE Navigator)
20616161 Observational study of gene-disease association. (HuGE Navigator)
20598922 A higher TIMP expression favours deposition of connective tissue and thus thicker vein wall, reducing matrix turnover by suppression of protease activity in varicose veins.
20587546 Observational study of gene-disease association. (HuGE Navigator)
20514432 Data show that gene expression rates of MMP-2 and TIMP-1 were higher in ONFH biopsies whereas TIMP-2 and MMP-9 gene expression was not significantly altered.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20484597 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20233321 Observations show an increased expression of TIMP-2 in periodontitis-affected gingival tissues. Moreover, the balance between MT1-MMP and its inhibitor TIMP-2 was altered in periodontitis-affected tissues.
20216978 TIMP-2 protein level also increased significantly in the hypoxia/reoxygenation groups, compared with the normoxic group.
20215736 changes in the extracellular matrix metabolism during the ageing process influence the level of circulating MMP-3 and MMP-10, as well as their tissue inhibitors TIMP-1 and TIMP-2, in a healthy population
20195229 Study confirms an altered TIMP2 expression in subjects with chronic C hepatitis and such alterations can contribute to development of liver fibrosis.
20149706 This study assessed the impact of exercise on inflammatory markers and MMPs, and TIMPs. No significant changes were found in body mass index, waist/hip ratio, insulin-resistance indices, MMP-2 and TIMP-1 throughout the study in either group.
20138860 The TIMP-2 -418G>C polymorphism is significantly associated with an increased susceptibility to atrial fibrillation in Chinese Han patients with hypertensive heart disease.
20084057 TIMP-2 suppresses endothelial mitogenesis and angiogenesis by at least two mechanisms, one mediated by protein tyrosine phosphatase inhibition of VEGFR-2 activation, another involving direct activation of an IBMX-sensitive phosphodiesterase activity.
20041335 The primary tumors from patients with LR showed significantly higher percentage of TIMP-2 expression in stromal cells compared to primary tumors from patients with distant metastasis or primary tumors from patients without tumoral progression.
19933216 Meta-analysis of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19889076 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19883732 Endogenously expressed TIMP-2 has a neuroprotective role, and they imply that the inhibition of TIMP-2 expression by MPP(+) or 6-OHDA may contribute, in part, to neuronal cell death.
19875168 evaluates the mRNA expression profile of genes TIMP1, TIMP2, MMP2 and MMP9 in diagnostic bone marrow samples from 134 consecutive ALL children by real-time quantitative PCR
19844095 TIMP-2 gene polymorphism is associated with intracerebral hemorrhage.
19844095 Observational study of gene-disease association. (HuGE Navigator)
19821096 in the degenerative phase of hemangioma, TIMP-2 can inhibit the proliferation of endothelial cells
19758569 Observational study of gene-disease association. (HuGE Navigator)
19727008 Mitral TIMP2 expression is higher in patients with mitral chordae tendinae rupture and there is a synergistic effect of mitral TIMP2 staining with hypertension on its occurrence
19723139 TIMPs were immunoreactive mainly in epithelium rather than in stroma of pleomorphic adenomas of salivary glands.
19709349 Of MMP-2/TIMP-2/MMP-14 complex, high expression of MMP-2, TIMP-2 & MMP-14 mRNA may contribute to local invasiveness of ameloblastoma; local invasive capacity of ameloblastoma more likely related to high transcription levels of TIMP-2 and MMP-14.
19698156 Higher amniotic fluid MMP-2 and TIMP-2 levels are found in women who eventually develop preeclampsia.
19640333 Determination of TIMP-2 in pleural fluid may contribute to differentiate TP from MP. The results suggest that overproduction of MMP-9 and TIMP-2 is associated with accumulation of the pleural effusion in malignancy.
19596921 expression of TIMP-2 mRNA in the stage IA and stage IBIIIB tumors did not register any statistically significant difference
19551841 both the interactions of TIMP-2 with MT1-MMP, and the conventional inhibition of MT1-MMP's catalytic activity by TIMP-2, play a role in the invasion-promoting function of MT1-MMP
19551542 The migration of bone marrow (BM) mesenchymal stromal cells was the result of the variable level of MMP/TIMP in response to inflammatory stimuli.
19546837 Data show there was a significant correlation between the level of TGF-[beta]1 and the levels of MMP-2 and TIMP-2 immunostainings in pancreatic ductal epithelium.
19464975 TIMP2 higher expression in scar tissues than controls
19438747 increased expression of TIMP-2 in keloids compared with mature scars
19431211 Single nucleotide polymorphisms in the TIMP-2 gene is associated with breast cancer.
19431211 Observational study of gene-disease association. (HuGE Navigator)
19391484 Our study revealed increased immunoexpression of MMP-2, MMP-9 and TIMP-2 in acute cellular rejection of renal allografts.
19383344 TIMP-1 was up-regulated in human colorectal cancer samples compared with normal tissue, while TIMP-2 was down-regulated.
19358835 Obese children and adolescents had higher circulating MMP-8 concentrations, lower plasma TIMP-1 concentrations, and higher MMP-8/TIMP-1 ratios than non obese controls.
19331801 Combined hyperlipidemic patients have increased levels of prothrombotic and microinflammatory parameters and higher levels of MMP-2, MMP-9, TIMP-1, and TIMP-2 than control subjects.
19317417 Study showed that MMP-9 and TIMP-2 were highly produced in brain microvessels while MMP-10 was notably increased in neurons of the ischemic brain but not in healthy areas.
19267203 TFPI-2 downregulation can contribute to tumour invasion of lung cancer cells
19241124 selective COX-2 inhibition suppresses the invasion activity of OSCC cells via down-regulation of an MMP-2-activating mechanism involving TIMP-2 and production of the MMP-2 protein by an interaction between cancer cells and stromal fibroblasts
19187648 TIMP-2 expression in human malignant glioma cells was up regulated by mutant IkappaBalpha.
19141395 The results revealed that mononuclear cells were highly immunoreactive for TIMP-1, TIMP-2 and MMP-9 during viral meningitis and that the expression of TIMPs in polymorphonuclear cells was even higher during bacterial meningitis.
19088110 uterine decidua possesses protease activity in situ and in vitro and uterine natural killer cells are a major source of MMP-2 and TIMP-2
19020757 Serous and mucinous ovarian tumors express different profiles of TIMP-2.
18702016 This case-control study investigates the possible impact of genetic variants of the TIMP-2 gene in the aetiology of AAA and to reproduce a recently described significant difference in allele frequency of the SNP 303G>A in a German population.
18702016 Observational study of gene-disease association. (HuGE Navigator)
18674955 Observational study of gene-disease association. (HuGE Navigator)
18634035 Observational study of gene-disease association. (HuGE Navigator)
18543216 TIMP-2 -418G/C polymorphisms were not associated with the risk of developing endometriosis or adenomyosis
18543216 Observational study of gene-disease association. (HuGE Navigator)
18498066 Aggressive forms of gastric cancer are associated with low TIMP-2 expression.
18487063 hematopoiesis was not adversely affected by TIMP-1 or TIMP-2
18477480 Comparison of TIMP2 levels in preeclampsia and gestational hypertension with those found in normotensive pregnancies.
18474097 Upregulation of TIMP-2 production is one mechanism by which prodrug JS-K mediates its anti-invasive effects
18472160 TIMP-2 overproduction is associated with bone marrow stromal cells in multiple myeloma
18469019 Identification of two previously unreported SNPs in FGFR1 and FABP3 associated with BMD and a third SNP in TIMP2 related to risk for non-vertebral osteoporotic fractures.
18469019 Observational study of gene-disease association. (HuGE Navigator)
18424416 The TIMP-2 G-418C SNP may be associated with the risk of different histological subtypes of epithelial ovarian cancer.
18424416 Observational study of gene-disease association. (HuGE Navigator)
18329693 This study suggests that MMP14 is involved mostly in prostate cancer implantation and that MMP2 and TIMP2 expression by reactive stromal cells might be used as predictors of diease-free survival in T3N0-2M0 Pca.
18301898 no significant association between TIMP-2 polymorphisms and Osteoarthritis was observed
18301898 Observational study of gene-disease association. (HuGE Navigator)
18291374 TIMP-1, -2, and -3 are significantly reduced by chorionic gonadotropin in endometrial stromal cells.
18288718 There was no association with TIMP-2 polymorphisms and risk of adenomyosis in North Chinese women.
18288718 Observational study of gene-disease association. (HuGE Navigator)
18265895 Crucial participants in tumour invasion and metastases are matrix metalloproteinases, tissue inhibitor of metalloproteinase inhibitors and cellular adhesion molecules. They play roles in tumour invasion and metastasis in non-small-cell lung carcinomas.
18260263 There was correlation between TIMP-2 expression and tumor size and grading observed. We didn't find any correlation between TIMP-2 and nodal metastases, recurrence and survival.
18217401 MMP-2, TIMP-1 and TIMP-2 levels are significantly higher and MMP-9 lower in children with chronic hepatitis B
18177649 Report association of polymorphisms of the MMP-2 and TIMP-2 genes with the risk of endometriosis in North Chinese women.
18177649 Observational study of gene-disease association. (HuGE Navigator)
18042068 MMP-2, MMP-9, TIMP-1 and TIMP-2 play an important role in the pathogenesis of non-melanoma skin cancer. The immunoexpression of these proteins may be useful indicators of cutaneous cancer invasion and progression.
18025061 No significant difference was seen in gene expression level of MMPs, TIMPs and ratio of MMPs/TIMPs in ascending aorta and AV between patients with BAV and TAV.
17991754 Findings illustrate a novel role for MT1-MMP-TIMP-2 interaction, which controls cell functions by a mechanism independent of extracellular matrix degradation.
17979129 gravitational unloading led to induction of TIMP2, an inhibitor of angiogenesis, in microvascular endothelial cells
17954022 TIMP-2 G-418C polymorphism increases risk of gastric cancer in a Chinese population, especially in younger subjects and smokers.
17954022 Observational study of gene-disease association. (HuGE Navigator)
17901377 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17893005 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17886098 MMP-2, MT1-MMP and TIMP-2 mRNA expression levels were correlated with clinical stages and histological subtypes of thymic epithelial tumours. The activation of pro-MMP-2 might be mediated by MT1-MMP and TIMP-2 up-regulation.
17868665 Observational study of gene-disease association. (HuGE Navigator)
17868665 elderly Chinese with TIMP2 C-allele have higher magnitude of QT dispersion and QTc dispersion prolongation
17786346 Increased Timp-2 is assopciated with squamous cell laryngeal carcinoma
17706812 MMP-9, but not TIMP-1 nor MMP-2 expression is increased in plaques causing acute coronary syndrome.
17613170 Results determine the level of MMP-2, its natural inhibitor TIMP-2, their ratio and HER-2/neu as diagnostic and prognostic factors in breast cancer.
17589947 Observational study of gene-disease association. (HuGE Navigator)
17572184 incidental clear cell renal cell carcinomas strongly expressing MMP-9 and TIMP-2 have a higher nulclear grade(worse prognosis).
17564313 Expression of TIMP2 was evaluated in hepatocellular carcinoma and surrounding non-tumor tissue.
17495113 MMP/TIMP balance seems to play an essential role in transferring mechanical signals into mesenchymal stem cells function.
17493602 Results of this study suggest that Systemic sclerosis patients with anticentromere antibodies positivity, after a primary fibrogenetic noxa, react with a more abundant release of MMP/TIMP, whereas patients with anti-Scl70 antibody show a normal response.
17493172 The expression of TIMP2 is significantly decreased in floppy valves compared to normal valves.
17448043 Observational study of gene-disease association. (HuGE Navigator)
17448043 the -418G to C gene polymorphism is associated with generalized aggressive periodontitis in Chinese subjects
17374529 The results indicate that TIMP-2 and MMP-2:TIMP-2 complex associate with favorable clinical course and could be used as a novel prognostic indicators in bladder cancer.
17350093 Positive correlation was found between hepatosplenomegaly and the MMP-2/TIMP-2 ratios (p=0.005 and 0.009) and between CNS involvement and the MMP-2/TIMP-2 ratio
17342343 Observational study of gene-disease association. (HuGE Navigator)
17342343 TIMP-2 polymorphism is strongly associated with an increased risk of OSCC in Europeans carrying the low C allele expression.
17325663 downregulation of the TIMP-2 gene is associated with promoter methylation and that this may play an important role in prostate cancer progression during the invasive and metastatic stages of the disease
17236757 Observational study of gene-disease association. (HuGE Navigator)
17226791 The aim of the present study was to investigate the effect of P. gingivalis on the expression and production of MMP-2, MMP-9, TIMP-1, and TIMP-2 by oral fibroblasts and epithelial cells.
17222415 TIMP-1 and TIMP-2 have a differential relationship with haemostatic proteins and roles in hemostasis and thrombogenesis
17203468 Results describe the opposite effects of high glucose on matrix metalloproteinase-2 and tissue inhibitor of metalloproteinase-2 in human endothelial cells.
17130843 TIMP2 and TIMP3 play functional role in LPA-induced invasion as negative regulators.
17106248 Expression of TIMP-2 enhances the antitumor efficacy of a replicating adenovirus in vivo, by reducing both tumor growth and angiogenesis.
17071711 TIMP-2 is abundant in the ovarian perifollicular stroma. Its median level increased in the early ovulatory phase.
17067460 Expression of TIMP-2 consequently increased with the increase of MMP2 and MT1-MMP in oral lichen planus.
17030988 TIMP-2 has a role in the pericyte-induced stabilization of newly formed vascular networks that are predisposed to undergo regression and reveal specific molecular targets of the inhibitors regulating these events.
17008230 TIMP-1 may serve as a useful laboratory marker to predict the clinical outcome of patients presenting with severe sepsis.
16940985 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16776850 When all three proteases are studied in combination, a tendency was found for tumors with high MMP-2, high MMP-14 and low TIMP-2 expression to predict a poor prognosis but the results did not reach significance
16772717 Increase in serum levels eight days after IVIG treatment in neuromuscular disease.
16728425 an imbalance between the MMP-2 and TIMP-2, caused primarily by an increase in TIMP-2 activity, contributes to the pathogenesis of diabetic nephropathy.
16723886 Presence of a G/C heterozygous genotype at position -418 in TIMP2 promoter could be a genetic predisposing factor for familial moyamoya disease.
16716258 TIMP-2 mediated alteration in cell morphology requires Rap1, TIMP-2 may recruit Rap1 to sites of actin cytoskeleton remodeling necessary for cell spreading, and enhanced cell adhesion by TIMP-2 expression may hinder cell migration
16631927 TIMP-1 and TIMP-2 are major serum factors that stimulate the induction of TIMP-1 mRNA in quiescent human gingival fibroblasts (Gin-1 cells) at mid-G1 (6-9 h after serum stimulation) of the cell cycle, but not that of TIMP-2.
16623785 TIMP-2 reactivity in capillaries and fibroblasts was decreased in congenital diaphragmatic hernia lungs.
16491114 TIMP-2-mediated inhibition of Src kinase activity leads to the signaling switch from Rac1 to Rap1, thereby leading to enhanced RECK expression.
16429190 TIMP-2 regulates the activity of MMPs in the extracellular matrix. The high frequency of GG genotype in the TIMP-2 gene promoter showed this site was unsuitable for studies of DNA polymorphism-disease associations in the studied population.
16425263 The colocalization of EMMPRIN, MT1-MMP and TIMP-2 in human cervical carcinomas seems to be involved in a specific distribution pattern of tumor cell bound MMP-2, which is related with local proteolytic activity.
16424893 Results of this study provide evidence that TIMP-2 immunoreactive protein is prognostic in estimation of the aggressive clinical course of head and neck squamous cell carcinoma.
16326706 Shp-1 mediates the antiproliferative activity of tissue inhibitor of metalloproteinase-2
16275157 Observational study of gene-disease association. (HuGE Navigator)
16237750 With tumor progression and development of heterogeneity, the abnormal expressions of MMP-9, TIMP-2, and E-cadherin or DNA aneuploid rate or high SPF gradually increases, suggesting that they play a crucial role in gastric carcinoma progression
16142692 Pro-MMP-2 and TIMP-2 levels negatively correlated in herniated discs samples
16142392 TIMP-2 may play an important role in the invasion and metastasis of oral squamous cell carcinoma.
16103240 Cardiac expression of TIMP-1 and TIMP-2 is significantly increased in chronic pressure-overloaded human hearts compared with controls and is related to the degree of interstitial fibrosis
16042227 a magnetic resonance imaging (MRI) measure of disease activity in multiple sclerosis patients during treatment with rIFNbeta-1a.
16036783 A decreased activity of TIMP-2 plays a role in inguinal hernia development.
15944607 Observational study of gene-disease association. (HuGE Navigator)
15870703 promoter hypermethylation of TIMP-2 is a novel epigenetic event in the pathogenesis of lymphoid malignancies
15841325 evidence that cell density influences the invasive potential of tumor cells via regulation of MMPs and TIMP-1 and TIMP-2 by AP-1, NF kappa B and CRE transcription factors
15797648 altered MMP/TIMP ratios in maternal blood during gestational hypertension
15754326 Down-regulation of TIMP-2 is associated with nonsmall cell lung carcinoma
15691353 Observational study of gene-disease association. (HuGE Navigator)
15691234 Observational study of gene-disease association. (HuGE Navigator)
15672858 Observational study of gene-disease association. (HuGE Navigator)
15628723 Expression in colorectal carcinomas relating to size and invasiveness of the tumor.
15616792 This study found an up-regulation of TIMP-1, TIMP-2 and MMP-2 RNA in Duchenne Muscular Dystrophy muscle.
15567754 MMP-2 plays an essential role in tumor invasion and metastasis, while TIMP-2 is shown to strongly inhibit cancer invasion and metastasis.
15557756 The expression of MMP-9, TIMP-1 and TIMP-2 was lower in the benign and low malignancy ovarian tumors compared with the malignant ones.
15489233 clearance of pro-matrix metalloproteinase (MMP)-2.tissue inhibitor of MMPs (TIMP-2) complex involves binding to the cell membrane and subsequent low density lipoprotein receptor-related protein (LRP)-dependent internalization and degradation
15351863 data suggest that the MMP-2/TIMP2 system and an activated extrinsic coagulation pathway could cooperate in conditions of elevated SOX and could influence arterial remodeling resulting in the presence of CVD in haemodialysis patients
15308656 analysis of the molecular basis of the inactivity of tissue inhibitor of metalloproteinase-2 against tumor necrosis factor-alpha-converting enzyme
15277439 Plasma levels are increased in type 2 diabetic patients
15248826 marked difference in MMPs and their inhibitors in the in vitro fertilized women and normally ovulating women
15247230 ERK 1/2- and p38 MAPK-modulated TIMP-2 expression regulates MT1-MMP activity and control TGF-beta1-induced pericellular collagenolysis
15225209 Dermal wound healing in red Duroc pigs show unique mRNA expression of HSP47,BMP-1,TIMP1-3 and hypercontracted,hyperpigmented scars.
15193960 Observational study of genotype prevalence. (HuGE Navigator)
15147743 TIMP2 promotes growth of A549 lung cells, accompanied by increase in NF-kappaB activity and downregulation of IkappaBalpha and beta proteins and later increases in Bcl-3, IkappaB, and cyclin D1 proteins.
15056834 TIMP-2 correlated negatively with fractional shortening & positively with LV dimension. Changes in the release & activity of TIMP-2 may be associated with the mechanisms responsible for cardiac remodeling in patients with hypertrophic cardiomyopathy.
15052627 hereditary neuralgic amyotrophy is not caused by point mutations of tissue inhibitor of metalloproteinase 2
14983226 MMP-2, TIMP-1 and TIMP-2 are downregulated in human orthotopic liver transplantation
14973177 MMP and TIMP may be involved in the feto-neonatal development and may contribute to the pathogenesis of bronchopulmonary dysplasia and/or intraventricular hemorrhage in critically ill preterm neonates
14962256 TIMP-2 is shown to correlate with systemic symptoms in Hodgkin lymphoma
14744773 MMP-26 was colocalized with MMP-9, TIMP-2, and TIMP-4 in breast cancer cells.
14712492 TIMP-2 is hypermethylated in human cervical cancer
14710472 Tissue from lateral and medial rectus muscles had different levels of expression of TIMP-1 and 2, MMP-2, and BMP-4, which may underlie different characteristics of these extraocular muscles and may influence wound healing after strabismus surgery.
14661256 effect of titanium, zirconia and alumina ceramics on activity and secretion in human osteoblasts
14654538 TIMP-2 stromal cell expression only was associated with adverse prognosis of urothelial bladder cancer patients.
14605322 Observational study of gene-disease association. (HuGE Navigator)
14605322 Our analysis of the entire coding region of TIMP-1, -2, and -3, which are the main inhibitors of metalloproteinase activity in the extracellular matrix, failed to show an association between genetic polymorphisms and an intracranial aneurysm
14604886 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14598888 A gradual, time-dependent decline in TIMP-2 mRNA expression was observed in the presence of the synthetic androgen analogue R1881.
14517716 A bivariate analysis revealed a modest but significant genetic correlation between TIMP-1 and TIMP-2.
12970724 palpable tumours demonstrated significantly more MMP-2 and significantly less MMP-9 expression than nonpalpable tumours
12970394 TIMP-2 expression is markedly increased in clear cell carcinoma of the ovary, suggesting a role of TIMP-2 in its unique characteristics among ovarian cancers
12900406 TIMP-2 possesses two distinct types of anti-angiogenic activities which can be uncoupled from each other
12887919 TIMP-2 mediated inhibition of angiogenesis is an MMP-independent mechanism.
12614934 TIMP-2 was significantly increased in CSF of Alzheimer's disease and Huntington's disease patients.
12602913 TIMP-2 expression in breast cancer is related to survival.
12479097 The over-expression of MMP-2, MMP-9, TIMP-1, and TIMP-2 may play a key role in invasion and lymph-node metastasis of in squamous carcinoma of the cervix.
12475252 Progress curve analysis of MMP inhibition by TIMP-2 shows that it has lower reactivity with MMPs at less acidic conditions than TIMP-4.
12470034 Changes in plasma MMP-2 and TIMP-2 concentrations during cardiopulmonary bypass may play an important role in LV remodeling after cardiac surgery.
12446683 TIMP2 expression is regulated by the ERK/MAPK pathway
12439941 correlation between expression of MMP-2, TIMP-2 protein and the ratio of MMP-2/TIMP-2 and clinical-pathological parameters of patients with gallbladder carcinoma
12406369 This protein is present in normal and azoospermic human semen.
12374789 investigation of structural and functional differences between TIMP-4 and TIMP-2 by mutagenesis into C-terminal tails
12372458 endometrium from women with endometriosis expressed higher levels of MMP-2 and MT1-MMP and lower levels of TIMP-2 than did endometrium from normal women
12147251 role in activating ras proteins
11912288 TIMP-2 may be involved in the pathogenesis of gestational trophoblastic disease
11757622 Observational study of gene-disease association. (HuGE Navigator)
11606052 The growth of the primary melanoma cell lines was stimulated by TIMP-1 and inhibited by TIMP-2. In contrast, the growth of the visceral metastatic melanoma cell line was stimulated by TIMP-2.
11598182 HIV-1 Tat induced monocyte invasion is inhibited by anti-beta integrin Ab or tissue inhibitor of metalloproteinase (TIMP), indicating an interaction with beta integrins and TIMP
8757599 HIV-1 Tat induced monocyte invasion is inhibited by anti-beta integrin Ab or tissue inhibitor of metalloproteinase (TIMP), indicating an interaction with beta integrins and TIMP

AA Sequence

MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQ      1 - 70
YEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQ     71 - 140
KKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPP    141 - 210
KQEFLDIEDP                                                                211 - 220
//

Text Mined References (360)

PMID Year Title
26978018 [Matrix metalloproteinases 2 and 9, their endogenous regulators, and angiotensin-converting enzyme in cervical squamous cell carcinoma].
26823777 2015 Expression of MMP-9/TIMP-2 in nasal polyps and its functional implications.
26606754 2015 Urinary Tissue Inhibitor of Metalloproteinase-2 (TIMP-2) • Insulin-Like Growth Factor-Binding Protein 7 (IGFBP7) Predicts Adverse Outcome in Pediatric Acute Kidney Injury.
26556867 2015 Growth-stimulatory activity of TIMP-2 is mediated through c-Src activation followed by activation of FAK, PI3-kinase/AKT, and ERK1/2 independent of MMP inhibition in lung adenocarcinoma cells.
26551785 2015 Polymorphisms in the Promoters of the MMP-2 and TIMP-2 Genes Are Associated with Spontaneous Deep Intracerebral Hemorrhage in the Taiwan Population.
26539028 2015 TIMP1, TIMP2, and TIMP4 are increased in aqueous humor from primary open angle glaucoma patients.
26331622 2015 TIMP-2 Interaction with MT1-MMP Activates the AKT Pathway and Protects Tumor Cells from Apoptosis.
26329758 2015 Tissue Inhibitors of Metalloproteinase-1 and 2 and Obesity Related Non-Alcoholic Fatty Liver Disease: Is There a Relationship.
26278569 2015 MiR-761 Promotes Progression and Metastasis of Non-Small Cell Lung Cancer by Targeting ING4 and TIMP2.
26268417 2016 Increased expression of metalloproteinase-2 and -9 (MMP-2, MMP-9), tissue inhibitor of metalloproteinase-1 and -2 (TIMP-1, TIMP-2), and EMMPRIN (CD147) in multiple myeloma.
26191221 2015 miRNA-221 promotes proliferation, migration and invasion by targeting TIMP2 in renal cell carcinoma.
26148591 TIMP-2 G-418C polymorphism and cancer risk: A meta-analysis.
26130791 Polymorphisms of MMP9 and TIMP2 in Patients with Varicose Veins.
26071077 2015 Matrix metalloproteinase-9 and tissue inhibitor of matrix metalloproteinase-2: Prognostic biological markers in invasive prolactinomas.
25839957 2015 Tissue inhibitor of metalloproteinase 2 inhibits activation of the ?-catenin signaling in melanoma cells.
25826490 2015 Effects of therapy with two combinations of antibiotics on the imbalance of MMP-2÷TIMP-2 in chronic periodontitis.
25771900 2015 Prognostic significance of TIMP-2, MMP-2, and MMP-9 on high-grade serous ovarian carcinoma using digital image analysis.
25731730 2015 MiR-221/222 promote human glioma cell invasion and angiogenesis by targeting TIMP2.
25656607 2015 Prognostic impact of polymorphism of matrix metalloproteinase-2 and metalloproteinase tissue inhibitor-2 promoters in breast cancer in Tunisia: case-control study.
25579181 2015 TIMP-2 gene methylation in cervical precursor and invasive lesions.
25571919 2015 Alterations in enhancer of zeste homolog 2, matrix metalloproteinase-2 and tissue inhibitor of metalloproteinase-2 expression are associated with ex vivo and in vitro bone metastasis in renal cell carcinoma.
25552509 [Membrane type 1 matrix metalloproteinase (MT1-MMP) and the regulators of its activity as invasive factors in squamous cell cervical carcinomas].
25539555 2014 Polymorphisms in MMP-2 and TIMP-2 in Turkish patients with prostate cancer.
25524453 2014 Evaluation of urinary tissue inhibitor of metalloproteinase-2 in acute kidney injury: a prospective observational study.
25436070 2014 Role of matrix metalloproteinase (MMP) 2 and MMP-9 in soft tissue sarcoma.
25412957 2015 Stoichiometric expression of MMP-2/TIMP-2 in benign and malignant tumours of the salivary gland.
25405519 2015 Norcantharidin enhances TIMP?2 anti?vasculogenic mimicry activity for human gallbladder cancers through downregulating MMP?2 and MT1?MMP.
25300296 2014 Overexpression of matrix metalloproteinases in lung tissue of patients with primary spontaneous pneumothorax.
25280484 2014 The GC?+?CC genotype at position -418 in TIMP-2 promoter and the -1575GA/-1306CC genotype in MMP-2 is genetic predisposing factors for prevalence of moyamoya disease.
25259564 2014 Presence of matrix metalloproteinase-2 and tissue inhibitor matrix metalloproteinase-2 gene polymorphisms and immunohistochemical expressions in intracranial meningiomas.
25189251 2014 TIMP2 gene polymorphisms are associated with hypertension in patients with myocardial infarction.
25153995 2014 Overexpression of MMP-9 and its inhibitors in blood mononuclear cells after myocardial infarction--is it associated with depressive symptomatology?
25136829 2014 No correlation between TIMP2 -418 G>C polymorphism and increased risk of cancer: evidence from a meta-analysis.
25128867 2014 Association of tissue inhibitor of metalloproteinase gene polymorphisms and unexplained recurrent spontaneous abortions in Han Chinese couples.
25060386 Human cardiac fibroblast extracellular matrix remodeling: dual effects of tissue inhibitor of metalloproteinase-2.
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
24819588 2015 Mesenchymal stem cells inhibit breast cancer cell migration and invasion through secretion of tissue inhibitor of metalloproteinase-1 and -2.
24800696 2015 Immunoexpression of metalloproteinases 2 and 14 and TIMP-2 inhibitor in main types of primary gastric carcinomas and lymph node metastasis.
24799419 2014 Functional Significance of MMP3 and TIMP2 Polymorphisms in Cleft Lip/Palate.
24710006 2014 Affinity- and specificity-enhancing mutations are frequent in multispecific interactions between TIMP2 and MMPs.
24680659 2014 Significance of circulating matrix metalloproteinase-9 to tissue inhibitor of metalloproteinases-2 ratio as a predictor of disease progression in patients with metastatic renal cell carcinoma receiving sunitinib.
24675717 2014 Urinary TIMP-2 and IGFBP7 as early biomarkers of acute kidney injury and renal recovery following cardiac surgery.
24591757 2014 Immunohistochemical correlation of matrix metalloproteinase-2 and tissue inhibitors of metalloproteinase-2 in tobacco associated epithelial dysplasia.
24534323 2015 Gene polymorphism -418 G/C of tissue inhibitor of metalloproteinases 2 is associated with abdominal aortic aneurysm.
24479343 [Matrix metalloproteinases (MMP)--MMP-1,-2,-9 and its endogenous activity regulators in transformed by E7 oncogene HPV16 and HPV18 cervical carcinoma cell lines].
24475101 2014 Mitral tissue inhibitor of metalloproteinase 2 is associated with mitral valve surgery outcome.
24444603 2014 Upregulated miR-106a plays an oncogenic role in pancreatic cancer.
24440352 2014 MicroRNA-106a targets TIMP2 to regulate invasion and metastasis of gastric cancer.
24427326 2014 MiR-19a is correlated with prognosis and apoptosis of laryngeal squamous cell carcinoma by regulating TIMP-2 expression.
24403492 2014 Role of serum VEGFA, TIMP2, MMP2 and MMP9 in monitoring response to adjuvant radiochemotherapy in patients with primary cervical cancer--results of a companion protocol of the randomized NOGGO-AGO phase III clinical trial.
24395652 2014 Serum levels and tissue expression of matrix metalloproteinase 2 (MMP-2) and tissue inhibitor of metalloproteinases 2 (TIMP-2) in colorectal cancer patients.
24384769 2013 Matrix metalloproteinase 2 (MMP-2) and their tissue inhibitor 2 (TIMP-2) in gastric cancer patients.
24355694 2014 Clinical and prognostic role of circulating MMP-2 and its inhibitor TIMP-2 in HCC patients prior to and after trans-hepatic arterial chemo-embolization.
24335752 2014 Downregulation of reversion-inducing cysteine-rich protein with Kazal motifs in malignant melanoma: inverse correlation with membrane-type 1-matrix metalloproteinase and tissue inhibitor of metalloproteinase 2.
24212294 2013 Association between serum levels of pro-metalloproteinase 1, tissue inhibitor of metalloproteinases 1 and 2 and prevalent cardiovascular disease in a population-based study.
24210229 2014 Elevated expression levels of matrix metalloproteinase-9 in placental villi and tissue inhibitor of metalloproteinase-2 in decidua are associated with prolonged bleeding after mifepristone-misoprostol medical abortion.
24202705 2014 NEDD9 depletion leads to MMP14 inactivation by TIMP2 and prevents invasion and metastasis.
24112707 2013 Detection of a latent soluble form of membrane type 1 matrix metalloprotease bound with tissue inhibitor of matrix metalloproteinases-2 in periprosthetic tissues and fluids from loose arthroplasty endoprostheses.
24068394 2013 High variability in MMP2/TIMP2 and MMP9/TIMP1 expression in secondary liver tumors.
24042342 2014 siRNA knockdown of tissue inhibitor of metalloproteinase-1 in keloid fibroblasts leads to degradation of collagen type I.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23973519 2014 Urinary NGF, TGF-?1, TIMP-2 and bladder wall thickness predict neurourological findings in children with myelodysplasia.
23855590 2013 CAPN 7 promotes the migration and invasion of human endometrial stromal cell by regulating matrix metalloproteinase 2 activity.
23817219 2013 Temporal profile of matrix metalloproteinases and their inhibitors in a human endothelial cell culture model of cerebral ischemia.
23793312 Transcription activity of MMP-2 and MMP-9 metalloproteinase genes and their tissue inhibitor (TIMP-2) in acute coronary syndrome patients.
23791966 2013 Association of MMP2-1306C/T and TIMP2G-418C polymorphisms in retinal vein occlusion.
23769926 2013 Impacts and interactions of PDGFRB, MMP-3, TIMP-2, and RNF213 polymorphisms on the risk of Moyamoya disease in Han Chinese human subjects.
23708302 2013 Expression of MMP-1, MMP-9 and TIMP-2 in prostate carcinoma and their influence on prognosis and survival.
23673111 2013 Correlations between papillary thyroid cancer and peripheral blood levels of matrix metalloproteinase-2, matrix metalloproteinase-9, tissue inhibitor of metalloproteinase-1, and tissue inhibitor of metalloproteinase-2.
23661104 2013 Gelatinases and their tissue inhibitors in a group of subjects with metabolic syndrome.
23650722 [Interstitial collagenase, gelatinases A and B and their endogenous inhibitors in squamous cell cervical carcinomas].
23585206 2013 Concentration of gelatinases and their tissue inhibitors in pancreatic inflammatory and neoplastic tumors and their influence on the early postoperative course.
23563628 2013 Association of TIMP-1 and TIMP-2 gene polymorphisms with progression of liver fibrosis in patients with type C chronic liver disease.
23536957 2013 The role of MMP2 (-1306C>T) and TIMP2 (-418 G>C) promoter variants in age-related macular degeneration.
23491141 2013 Polymorphic variation within the ADAMTS2, ADAMTS14, ADAMTS5, ADAM12 and TIMP2 genes and the risk of Achilles tendon pathology: a genetic association study.
23472970 2013 Up-regulation of tissue inhibitor of metalloproteinase-2 promotes SHI-1 cell invasion in nude mice.
23427184 2013 Overexpression of endogenous TIMP-2 increases the proliferation of BeWo choriocarcinoma cells through the MAPK-signaling pathway.
23415672 2013 Role of serum concentration of VEGFR1 and TIMP2 on clinical outcome in primary cervical cancer: results of a companion protocol of the randomized, NOGGO-AGO phase III adjuvant trial of simultaneous cisplatin-based radiochemotherapy vs. carboplatin and paclitaxel containing sequential radiotherapy.
23412981 2013 Matrix metalloproteinases-2, -3 and tissue inhibitors of metalloproteinases-1, -2 in placentas from preterm pregnancies and their association with one-carbon metabolites.
23388612 2013 Discovery and validation of cell cycle arrest biomarkers in human acute kidney injury.
23388475 2012 Concentrations and activities of metalloproteinases 2 and 9 and their inhibitors (TIMPS) in chronic pancreatitis and pancreatic adenocarcinoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23371049 2013 TIMP-2 modulates cancer cell transcriptional profile and enhances E-cadherin/beta-catenin complex expression in A549 lung cancer cells.
23369618 2013 Whole-genome DNA methylation in skin lesions from patients with psoriasis vulgaris.
23320481 2013 Circulating matrix metalloproteinase MMP-9 and MMP-2/TIMP-2 complex are associated with spontaneous early pregnancy failure.
23264224 2012 Serum matrix metalloproteinase 2 and tissue inhibitor of matrix metalloproteinases 2 in esophageal cancer patients.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23205572 2013 MicroRNA-200b is overexpressed in endometrial adenocarcinomas and enhances MMP2 activity by downregulating TIMP2 in human endometrial cancer cell line HEC-1A cells.
23195431 2013 CD133 affects the invasive ability of HCT116 cells by regulating TIMP-2.
23038618 2013 A replication study for association of 5 single nucleotide polymorphisms with curve progression of adolescent idiopathic scoliosis in Japanese patients.
22985578 2012 [Correlation of the expressions of MMPs-9, TIMP-1 and TIMP-2 with cesarean section scar].
22985025 2013 Association between MMP-2 and TIMP-2 gene polymorphisms and advanced-stage endometriosis in Korean women.
22883459 2012 [Expression and significance of matrix metalloproteinase and tissue inhibitor of matrix metalloproteinase in non-melanoma skin cancer].
22880464 2012 [Expression of metalloproteinase MMP-9 and tissue inhibitor of metalloproteinase TIMP-2 in placenta of pregnant women with intrauterine growth restriction].
22820140 Expression of matrix metalloproteinase-2 and its tissue inhibitor-2 in fetal and neoplastic thyroid tissue and their significance as diagnostic and prognostic markers in papillary carcinoma.
22730240 2012 Association of MMP3 and TIMP2 promoter polymorphisms with nonsyndromic oral clefts.
22685266 2012 miR-200c is aberrantly expressed in leiomyomas in an ethnic-dependent manner and targets ZEBs, VEGFA, TIMP2, and FBLN5.
22621753 2012 Higher risk of matrix metalloproteinase (MMP-2, 7, 9) and tissue inhibitor of metalloproteinase (TIMP-2) genetic variants to gallbladder cancer.
22551568 2012 NUR77 inhibits the expression of TIMP2 and increases the migration and invasion of HTR-8/SVneo cells induced by CYR61.
22546345 2012 Knockdown of glucose-regulated protein 78 decreases the invasion, metalloproteinase expression and ECM degradation in hepatocellular carcinoma cells.
22532131 2012 The role of matrix metalloproteinases (MMPs) and their inhibitors (TIMPs) in the development of esophageal cancer.
22512703 2012 Expression of MMP-2, TIMP-2, TGF-?1, and decorin in Dupuytren's contracture.
22511598 2012 Enhanced immunoreactivity of TIMP-2 in the stromal compartment of tumor as a marker of favorable prognosis in ovarian cancer patients.
22438955 2012 HPV16 oncoproteins induce MMPs/RECK-TIMP-2 imbalance in primary keratinocytes: possible implications in cervical carcinogenesis.
22427646 2012 Matrix metalloproteinase-10 (MMP-10) interaction with tissue inhibitors of metalloproteinases TIMP-1 and TIMP-2: binding studies and crystal structure.
22374248 2012 Association of promoter polymorphisms in MMP2 and TIMP2 with prostate cancer susceptibility in North India.
22302011 2012 Matrix metalloproteinase (MMP)-2 genetic variants modify the circulating MMP-2 levels in end-stage kidney disease.
22272343 2012 The role of EZH2 in the regulation of the activity of matrix metalloproteinases in prostate cancer cells.
22270451 2012 Immunoreactivity for TIMP-2 is associated with a favorable prognosis in endometrial carcinoma.
22262409 2012 In hepatocellular carcinoma miR-519d is up-regulated by p53 and DNA hypomethylation and targets CDKN1A/p21, PTEN, AKT3 and TIMP2.
22200690 2012 Expression of MMP-2, -7, -9, MT1-MMP and TIMP-1 and -2 has no prognostic relevance in patients with advanced epithelial ovarian cancer.
22200256 2012 Metalloproteinases 2 and 9 and their tissue inhibitors 1 and 2 are increased in vulvar lichen sclerosus.
22169692 2011 [Association of polymorphism in matrix metalloproteinase-2 and tissue inhibitor of metalloproteinase-2 with genetic susceptibility of gastric cancer].
22122951 2011 Biochemical comparison of osteoarthritic knees with and without effusion.
22110735 2011 NDRG2 ameliorates hepatic fibrosis by inhibiting the TGF-?1/Smad pathway and altering the MMP2/TIMP2 ratio in rats.
22051851 2012 Temporal investigation of matrix metalloproteinases and their inhibitors in human cervicovaginal fluid in late pregnancy and labor.
22020421 2012 Matrix metalloproteinase-2 promoter and tissue inhibitor of metalloproteinase-2 gene polymorphisms in non-Hodgkin's lymphoma.
21871510 2011 An integrin-binding N-terminal peptide region of TIMP-2 retains potent angio-inhibitory and anti-tumorigenic activity in vivo.
21839835 2011 Peptide from the C-terminal domain of tissue inhibitor of matrix metalloproteinases-2 (TIMP-2) inhibits membrane activation of matrix metalloproteinase-2 (MMP-2).
21786179 2012 Comparative study of the immunohistochemical expression of tissue inhibitors of metalloproteinases 1 and 2 between clearly invasive carcinomas and "in situ" trophoblast invasion.
21732829 2011 Wnt signaling and Dupuytren's disease.
21715326 2011 Phage display of tissue inhibitor of metalloproteinases-2 (TIMP-2): identification of selective inhibitors of collagenase-1 (metalloproteinase 1 (MMP-1)).
21620625 2011 Serum metalloproteinases MMP-2, MMP-9, and metalloproteinase tissue inhibitors in patients are associated with arteriovenous fistula maturation.
21526499 2011 Clinical significance of serum levels of matrix metalloproteinase 2 (MMP-2) and its tissue inhibitor (TIMP-2) in gastric cancer.
21478099 2010 Matrix metalloproteinase 2 and tissue inhibitor of matrix metalloproteinases 2 in the diagnosis of colorectal adenoma and cancer patients.
21463121 2011 Associations between regulators of extracellular matrix and hemostatic factors in hematologic neoplasias.
21462296 2011 Variation in FGF1, FOXE1, and TIMP2 genes is associated with nonsyndromic cleft lip with or without cleft palate.
21454617 2011 Entropy increases from different sources support the high-affinity binding of the N-terminal inhibitory domains of tissue inhibitors of metalloproteinases to the catalytic domains of matrix metalloproteinases-1 and -3.
21437624 2011 Imbalanced circulating matrix metalloproteinases in polycystic ovary syndrome.
21432777 2011 Distribution of matrix metalloproteinases MMP-1, MMP-2, MMP-8 and tissue inhibitor of matrix metalloproteinases-2 in nasal polyposis and chronic rhinosinusitis.
21427648 2011 Circulating matrix metalloproteinases and their inhibitors in inguinal hernia and abdominal aortic aneurysm.
21421877 2011 Systematic investigation of the relationship between high myopia and polymorphisms of the MMP2, TIMP2, and TIMP3 genes by a DNA pooling approach.
21261731 2011 Clinical characteristics of TIMP2, MMP2, and MMP9 gene polymorphisms in colorectal cancer.
21254651 2010 [Expression of tissue inhibitor of metalloproteinase-2 in nasopharyngeal carcinoma].
21228746 2012 A promoter polymorphism of tissue inhibitor of metalloproteinase-2 gene is associated with severity of thoracic adolescent idiopathic scoliosis.
21195432 2011 Polymorphisms in MMP-9 and TIMP-2 in Chinese patients with varicose veins.
21148412 2011 Reduced TIMP-2 in hypoxia enhances angiogenesis.
21086628 [Expression of matrix metalloproteinases 2 and 9 and their tissue inhibitors 1 and 2 in papillary thyroid cancer: an association with the clinical, morphological and ultrastructural characteristics of a tumor].
20948207 2010 Association of a functional polymorphism in the MMP-3 gene with Moyamoya Disease in the Chinese Han population.
20941509 2010 17?-estradiol reduces expression of MMP-1, -3, and -13 in human primary articular chondrocytes from female patients cultured in a three dimensional alginate system.
20940305 2010 The anti-angiogenic peptide, loop 6, binds insulin-like growth factor-1 receptor.
20889295 2011 A randomized placebo controlled trial of the effect of preoperative statin use on matrix metalloproteinases and tissue inhibitors of matrix metalloproteinases in areas of low and peak wall stress in patients undergoing elective open repair of abdominal aortic aneurysm.
20730428 2010 Clinical impact of MMP and TIMP gene polymorphisms in gastric cancer.
20718757 2010 Exogenous introduction of tissue inhibitor of metalloproteinase 2 reduces accelerated growth of TGF-?-disrupted diffuse-type gastric carcinoma.
20707923 2010 Matrix metalloproteinase-3 promoter polymorphisms but not dupA-H. pylori correlate to duodenal ulcers in H. pylori-infected females.
20694560 2011 Common genetic polymorphisms in moyamoya and atherosclerotic disease in Europeans.
20685029 2010 Expression of matrix metalloproteinase-2 and tissue inhibitors of metalloproteinase-1 (TIMP-1, TIMP-2 and TIMP-3) in women with uterine prolapse but without urinary incontinence.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20672350 2010 Genetic variants in COL2A1, COL11A2, and IRF6 contribute risk to nonsyndromic cleft palate.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20627004 2010 [Association between tissue inhibitor of metalloproteinase-2 gene polymorphism and adolescent idiopathic thoracic scoliosis].
20616161 2010 Functional polymorphisms in matrix metalloproteinases-1, -3, -9 are associated with arteriovenous fistula patency in hemodialysis patients.
20598922 2010 Inhibitory effect of TIMP influences the morphology of varicose veins.
20587546 2010 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in patients with chronic hepatitis C infection.
20514432 2010 Expression profile of matrix metalloproteinase-2 and -9 and their endogenous tissue inhibitors in osteonecrotic femoral heads.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20484597 2010 Association of matrix metalloproteinase gene polymorphisms with refractive error in Amish and Ashkenazi families.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20233321 2010 Involvement of MT1-MMP and TIMP-2 in human periodontal disease.
20216978 2010 In vitro reoxygenation following hypoxia increases MMP-2 and TIMP-2 secretion by human umbilical vein endothelial cells.
20215736 2011 Age- and gender-dependent changes in connective tissue remodeling: physiological differences in circulating MMP-3, MMP-10, TIMP-1 and TIMP-2 level.
20195229 2009 Altered pattern of circulating matrix metalloproteinases -2,- 9 and tissue inhibitor of metalloproteinase-2 in patients with HCV-related chronic hepatitis. Relationship to histological features.
20149706 2010 Exercise ameliorates serum MMP-9 and TIMP-2 levels in patients with type 2 diabetes.
20138860 2010 MMP-2 and TIMP-2 gene polymorphisms and susceptibility to atrial fibrillation in Chinese Han patients with hypertensive heart disease.
20084057 2010 TIMP-2 modulates VEGFR-2 phosphorylation and enhances phosphodiesterase activity in endothelial cells.
20041335 2010 Expression of metalloproteases and their inhibitors in primary tumors and in local recurrences after mastectomy for breast cancer.
19933216 2010 The COPD genetic association compendium: a comprehensive online database of COPD genetic associations.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19889076 2009 Host single nucleotide polymorphisms of MMP-9 -1562/TIMP-1 372 have gender differences in the risk of gastric intestinal metaplasia after Helicobacter pylori infection.
19883732 2010 The neuroprotective role of tissue inhibitor of metalloproteinase-2 in MPP+- or 6-OHDA-treated SK-N-BE(2)C and SH-SY5Y human neuroblastoma cells.
19875168 2010 mRNA expression of matrix metalloproteinases (MMPs) 2 and 9 and tissue inhibitor of matrix metalloproteinases (TIMPs) 1 and 2 in childhood acute lymphoblastic leukemia: potential role of TIMP1 as an adverse prognostic factor.
19844095 2009 TIMP-2 gene polymorphism is associated with intracerebral hemorrhage.
19821096 2009 Expression of matrix metalloproteinase and its tissue inhibitor in haemangioma.
19758569 2009 Genetic polymorphism of the tissue inhibitor of metalloproteinase-1 is associated with an increased risk of endometrial cancer.
19727008 2009 Synergistic effect of mitral expression of tissue inhibitor of metalloproteinase-2 with hypertension on the occurrence of mitral chordae tendinae rupture.
19723139 2009 Expression of matrix metalloproteinases MMP-2, MMP-9 and their tissue inhibitors TIMP-1 and TIMP-2 in the epithelium and stroma of salivary gland pleomorphic adenomas.
19709349 2010 Expression and role of metalloproteinase-2 and endogenous tissue regulator in ameloblastoma.
19698156 2009 Matrix metalloproteinase-2 is elevated in midtrimester amniotic fluid prior to the development of preeclampsia.
19640333 2009 Potential role of matrix metalloproteinase-2,-9 and tissue inhibitors of metalloproteinase-1,-2 in exudative pleural effusions.
19596921 2009 Expression of MMP-7, MMP-9, TIMP-1 and TIMP-2 mRNA in lung tissue of patients with non-small cell lung cancer (NSCLC) and benign pulmonary disease.
19551841 2010 Timp-2 binding with cellular MT1-MMP stimulates invasion-promoting MEK/ERK signaling in cancer cells.
19551542 2009 In vitro study of matrix metalloproteinase/tissue inhibitor of metalloproteinase production by mesenchymal stromal cells in response to inflammatory cytokines: the role of their migration in injured tissues.
19546837 2009 Differences in pancreatic immunohistochemical staining profiles of TGF-beta1, MMP-2, and TIMP-2 between autoimmune and alcoholic chronic pancreatitis.
19464975 2010 Matrix metalloproteinases and tissue inhibitors of metalloproteinases in patients with different types of scars and keloids.
19438747 2009 Promoted activation of matrix metalloproteinase (MMP)-2 in keloid fibroblasts and increased expression of MMP-2 in collagen bundle regions: implications for mechanisms of keloid progression.
19431211 2009 Polymorphisms in tissue inhibitors of metalloproteinases-2 and -3 and breast cancer susceptibility and survival.
19391484 2008 Aberrant tubulointerstitial immunoexpression of matrix metalloproteinases MMP-2, MMP-9 and tissue inhibitor of matrix proteinase-2 (TIMP-2) in acute cellular rejection of human renal allograft.
19383344 2008 TIMP-1 expression in human colorectal cancer is associated with TGF-B1, LOXL2, INHBA1, TNF-AIP6 and TIMP-2 transcript profiles.
19358835 2009 Assessment of matrix metalloproteinase (MMP)-2, MMP-8, MMP-9, and their inhibitors, the tissue inhibitors of metalloproteinase (TIMP)-1 and TIMP-2 in obese children and adolescents.
19331801 2009 Evaluation of metalloproteinase 2 and 9 levels and their inhibitors in combined dyslipidemia.
19317417 2009 Vascular MMP-9/TIMP-2 and neuronal MMP-10 up-regulation in human brain after stroke: a combined laser microdissection and protein array study.
19267203 2009 Transient RNA silencing of tissue factor pathway inhibitor-2 modulates lung cancer cell invasion.
19241124 2009 Inhibition of cyclooxygenase-2 suppresses the invasiveness of oral squamous cell carcinoma cell lines via down-regulation of matrix metalloproteinase-2 production and activation.
19187648 2009 The regulating role of mutant IkappaBalpha in expression of TIMP-2 and MMP-9 in human glioblastoma multiform.
19141395 2008 Immunohistochemical analysis of MMP-9, MMP-2 and TIMP-1, TIMP-2 expression in the central nervous system following infection with viral and bacterial meningitis.
19088110 2009 Localization of matrix metalloproteinase (MMP)-2, MMP-9 and tissue inhibitors for MMPs (TIMPs) in uterine natural killer cells in early human pregnancy.
19020757 2008 Serous and mucinous ovarian tumors express different profiles of MMP-2, -7, -9, MT1-MMP, and TIMP-1 and -2.
18702016 2008 [Analysis of tissue inhibitor of metalloproteinase-2 gene polymorphisms in a caucasian population with abdominal aortic aneurysms].
18674955 2009 Gene polymorphisms related to angiogenesis, inflammation and thrombosis that influence risk for oral cancer.
18634035 2009 Matrix metalloproteinases and their tissue inhibitors as prognostic indicators for diagnostic and surgical recurrence in Crohn's disease.
18543216 2008 [Study on the association of SNPs of MMP-2 and TIMP-2 genes with the risk of endometriosis and adenomyosis].
18498066 2008 Clinicopathological significance of MMP-2 and its specific inhibitor TIMP-2 in gastric cancer.
18487063 Hematopoiesis in mice is extremely resilient to wide variation in TIMP/MMP balance.
18477480 2008 Comparative assessment of matrix metalloproteinase (MMP)-2 and MMP-9, and their inhibitors, tissue inhibitors of metalloproteinase (TIMP)-1 and TIMP-2 in preeclampsia and gestational hypertension.
18474097 2008 TIMP-2 mediates the anti-invasive effects of the nitric oxide-releasing prodrug JS-K in breast cancer cells.
18472160 2008 Matrix metalloproteinases-1 and -2, and tissue inhibitor of metalloproteinase-2 production is abnormal in bone marrow stromal cells of multiple myeloma patients.
18469019 2008 Single nucleotide polymorphisms in new candidate genes are associated with bone mineral density and fracture risk.
18424416 2008 [Association of SNPs in the promoter of MMP-2 and TIMP-2 genes with epithelial ovarian cancer].
18329693 2008 Membrane-type-1 matrix metalloproteinase, matrix metalloproteinase 2, and tissue inhibitor of matrix proteinase 2 in prostate cancer: identification of patients with poor prognosis by immunohistochemistry.
18301898 2008 Association of TIMP-4 gene polymorphism with the risk of osteoarthritis in the Korean population.
18291374 2008 Human chorionic gonadotropin stimulates matrix metalloproteinases-2 and -9 in cytotrophoblastic cells and decreases tissue inhibitor of metalloproteinases-1, -2, and -3 in decidualized endometrial stromal cells.
18288718 2008 Polymorphisms in the matrix metalloproteinase-2 and tissue inhibitor of metalloproteinase-2 and the risk of human adenomyosis.
18265895 2008 MMP-2, TIMP-2 and CD44v6 expression in non-small-cell lung carcinomas.
18260263 2007 [Assessment of tissue inhibitor of metalloproteinases-2 (TIMP-2) in laryngeal cancer].
18217401 2007 Matrix metalloproteinases and their tissue inhibitors in children with chronic hepatitis B treated with lamivudine.
18177649 2008 Association of polymorphisms of the MMP-2 and TIMP-2 genes with the risk of endometriosis in North Chinese women.
18042068 2007 Differential expression of matrix metalloproteinase (MMP)-2, MMP-9 and tissue inhibitor of metalloproteinase (TIMP)-1 and TIMP-2 in non-melanoma skin cancer: implications for tumour progression.
18025061 2008 Matrix metalloproteinase expression in the ascending aorta and aortic valve.
17991754 2008 Tissue inhibitor of metalloproteinases-2 binding to membrane-type 1 matrix metalloproteinase induces MAPK activation and cell growth by a non-proteolytic mechanism.
17979129 2008 Gravitational unloading induces an anti-angiogenic phenotype in human microvascular endothelial cells.
17954022 2008 Tissue inhibitor of metalloproteinase-2 G-418C polymorphism is associated with an increased risk of gastric cancer in a Chinese population.
17901377 2007 Polymorphisms in MMP family and TIMP genes and carotid artery intima-media thickness.
17893005 2007 Multiple-polymorphism associations of 7 matrix metalloproteinase and tissue inhibitor metalloproteinase genes with myocardial infarction and angiographic coronary artery disease.
17886098 2007 Activation ratio of MMP-2 and expression of MT1-MMP are correlated in thymic epithelial tumours.
17868665 The C-allele of tissue inhibitor of metalloproteinases 2 is associated with increased magnitude of QT dispersion prolongation in elderly Chinese - 4-year follow-up study.
17786346 2007 Expression of metalloproteinases and their tissue inhibitors in squamous cell laryngeal carcinoma.
17706812 2008 Metalloproteinases-2, -9 and TIMP-1 expression in stable and unstable coronary plaques undergoing PCI.
17613170 2007 Clinical implications of HER-2/neu overexpression and proteolytic activity imbalance in breast cancer.
17589947 2007 Role of matrix metalloproteinase, tissue inhibitor of metalloproteinase and tumor necrosis factor-alpha single nucleotide gene polymorphisms in inflammatory bowel disease.
17572184 2007 Significant relationship of matrix metalloproteinase 9 with nuclear grade and prognostic impact of tissue inhibitor of metalloproteinase 2 for incidental clear cell renal cell carcinoma.
17564313 2004 Expression of matrix metalloproiteinases (MMPs) and tissue inhibitors of metalloproteinases (TIMPs) in hepatocellular carcinoma tissue, compared with the surrounding non-tumor tissue.
17495113 2007 Matrix metalloprotease activity is an essential link between mechanical stimulus and mesenchymal stem cell behavior.
17493602 2007 Relationship between matrix metalloproteinases/tissue inhibitors of matrix metalloproteinases systems and autoantibody patterns in systemic sclerosis.
17493172 2007 Role of matrix metalloproteinases and their tissue inhibitor of metalloproteinases in myxomatous change of cardiac floppy valves.
17448043 2007 MMP-2, MMP-9 and TIMP-2 gene polymorphisms in Chinese patients with generalized aggressive periodontitis.
17374529 2007 Serum tissue inhibitor of metalloproteinase-2 (TIMP-2) and matrix metalloproteinase-2 in complex with the inhibitor (MMP-2:TIMP-2) as prognostic markers in bladder cancer.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17350093 2007 Expression of matrix metalloproteinase (MMP) and tissue inhibitor of MMP (TIMP) genes in blasts of infant acute lymphoblastic leukemia with organ involvement.
17342343 2007 Strong association of the tissue inhibitor of metalloproteinase-2 polymorphism with an increased risk of oral squamous cell carcinoma in Europeans.
17325663 2007 Epigenetic inactivation of the tissue inhibitor of metalloproteinase-2 (TIMP-2) gene in human prostate tumors.
17236757 2007 Clinicopathological significance of MMP-2 and TIMP-2 genotypes in gastric cancer.
17226791 2007 Regulation of matrix metalloproteinases and tissue inhibitors of matrix metalloproteinases by Porphyromonas gingivalis in an engineered human oral mucosa model.
17222415 2007 Divergent associations of tissue inhibitors of metalloproteinases-1 and -2 with the prothrombotic/fibrinolytic state.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17203468 2007 Opposite effects of high glucose on MMP-2 and TIMP-2 in human endothelial cells.
17130843 2007 Lysophosphatidic acid downregulates tissue inhibitor of metalloproteinases, which are negatively involved in lysophosphatidic acid-induced cell invasion.
17106248 2006 Tissue inhibitor of metalloproteinases-2 improves antitumor efficacy of a replicating adenovirus in vivo.
17071711 2006 Gelatinases and their tissue inhibitors during human ovulation: increased expression of tissue inhibitor of matrix metalloproteinase-1.
17067460 2006 [The role of matrix metalloproteinases and their tissue inhibitors in oral lichen planus].
17030988 2006 Coregulation of vascular tube stabilization by endothelial cell TIMP-2 and pericyte TIMP-3.
17008230 2006 Matrix-metalloproteinases and their inhibitors are elevated in severe sepsis: prognostic value of TIMP-1 in severe sepsis.
16940985 2006 Clinical impact of MMP and TIMP gene polymorphisms in gastric cancer.
16776850 2006 The influence of MMP-14, TIMP-2 and MMP-2 expression on breast cancer prognosis.
16772717 2006 Serum levels of matrix metalloproteinases-2 and -9 and their tissue inhibitors in inflammatory neuromuscular disorders.
16728425 2006 An imbalance between matrix metalloproteinase-2 and tissue inhibitor of matrix metalloproteinase-2 contributes to the development of early diabetic nephropathy.
16723886 2006 Single nucleotide polymorphisms of tissue inhibitor of metalloproteinase genes in familial moyamoya disease.
16716258 2006 TIMP-2 promotes cell spreading and adhesion via upregulation of Rap1 signaling.
16631927 2006 Tissue inhibitors of metalloproteinases-1 (TIMP-1) and -2(TIMP-2) are major serum factors that stimulate the TIMP-1 gene in human gingival fibroblasts.
16623785 2006 The distribution of matrix metalloproteinases and tissue inhibitors of metalloproteinases in the lungs of congenital diaphragmatic hernia patients and age-matched controls.
16491114 2006 TIMP-2 upregulates RECK expression via dephosphorylation of paxillin tyrosine residues 31 and 118.
16429190 2005 Analysis of MMP-9 and TIMP-2 gene promoter polymorphisms in individuals with hypodontia.
16425263 2006 EMMPRIN-induced MMP-2 activation cascade in human cervical squamous cell carcinoma.
16424893 2006 Tissue and circulating immunoreactive protein for MMP-2 and TIMP-2 in head and neck squamous cell carcinoma--tissue immunoreactivity predicts aggressive clinical course.
16326706 2006 Shp-1 mediates the antiproliferative activity of tissue inhibitor of metalloproteinase-2 in human microvascular endothelial cells.
16275157 2006 The role of genetic polymorphisms in the promoters of the matrix metalloproteinase-2 and tissue inhibitor of metalloproteinase-2 genes in head and neck cancer.
16237750 2005 DNA ploidy analysis and expression of MMP-9, TIMP-2, and E-cadherin in gastric carcinoma.
16142692 Alterations in biochemical components of extracellular matrix in intervertebral disc herniation: role of MMP-2 and TIMP-2 in type II collagen loss.
16142392 2005 Expression of matrix metalloproteinase 2 and its tissue inhibitor in oral squamous cell carcinoma.
16103240 2005 Increased cardiac expression of tissue inhibitor of metalloproteinase-1 and tissue inhibitor of metalloproteinase-2 is related to cardiac fibrosis and dysfunction in the chronic pressure-overloaded human heart.
16042227 2005 Serum MMP-9/TIMP-1 and MMP-2/TIMP-2 ratios in multiple sclerosis: relationships with different magnetic resonance imaging measures of disease activity during IFN-beta-1a treatment.
16036783 Role of TIMP-2 in fascia transversalis on development of inguinal hernias.
15944607 2005 Genetic analysis of polymorphisms in biologically relevant candidate genes in patients with abdominal aortic aneurysms.
15870703 2005 Inactivation of the tissue inhibitor of metalloproteinases-2 gene by promoter hypermethylation in lymphoid malignancies.
15841325 2005 Transcriptional control of cell density dependent regulation of matrix metalloproteinase and TIMP expression in breast cancer cell lines.
15797648 2005 Circulating matrix metalloproteinase-9 and tissue inhibitors of metalloproteinases-1 and -2 levels in gestational hypertension.
15760767 2005 TIMP-2: an endogenous inhibitor of angiogenesis.
15754326 2005 Tissue inhibitor of metalloproteinase 1 is an independent predictor of prognosis in patients with nonsmall cell lung carcinoma who undergo resection with curative intent.
15691353 2005 Analysis of the MMP-9 (C-1562 T) and TIMP-2 (G-418C) gene promoter polymorphisms in patients with chronic periodontitis.
15691234 2005 Promoter activity of human tissue inhibitor of metalloproteinase 2 gene with novel single nucleotide polymorphisms.
15672858 2005 Association analysis of tissue inhibitor of metalloproteinase2 gene polymorphisms with COPD in Egyptians.
15628723 Advanced colorectal carcinomas measuring 20 mm or less exhibit markedly higher invasiveness despite their size.
15616792 2005 Increased mRNA expression of tissue inhibitors of metalloproteinase-1 and -2 in Duchenne muscular dystrophy.
15567754 2004 The ratio of MMP-2 to TIMP-2 in hilar cholangiocarcinoma: a semi-quantitative study.
15557756 Matrix metalloproteinases 2 and 9 and their tissue inhibitors in low malignant potential ovarian tumors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15489233 2004 Low density lipoprotein receptor-related protein mediates endocytic clearance of pro-MMP-2.TIMP-2 complex through a thrombospondin-independent mechanism.
15351863 2004 Extrinsic coagulation pathway activation and metalloproteinase-2/TIMPs system are related to oxidative stress and atherosclerosis in hemodialysis patients.
15308656 2004 Delineating the molecular basis of the inactivity of tissue inhibitor of metalloproteinase-2 against tumor necrosis factor-alpha-converting enzyme.
15277439 2004 Matrix metalloproteinase-9 and tissue inhibitor of metalloproteinase-1 and -2 in type 2 diabetes: effect of 1 year's cardiovascular risk reduction therapy.
15248826 2004 Intrafollicular expression of matrix metalloproteinases and their inhibitors in normally ovulating women compared with patients undergoing in vitro fertilization treatment.
15247230 2004 Differential regulation of membrane type 1-matrix metalloproteinase activity by ERK 1/2- and p38 MAPK-modulated tissue inhibitor of metalloproteinases 2 expression controls transforming growth factor-beta1-induced pericellular collagenolysis.
15193960 2004 Ethnic differences of coronary artery disease-associated SNPs in two Israeli healthy populations using MALDI-TOF mass spectrometry.
15147743 2004 Tissue inhibitor of metalloproteinases-2 growth-stimulatory activity is mediated by nuclear factor-kappa B in A549 lung epithelial cells.
15056834 2004 Increased circulating matrix metalloproteinase-2 in patients with hypertrophic cardiomyopathy with systolic dysfunction.
15052627 2004 Genomic organization and mutation analysis of three candidate genes for hereditary neuralgic amyotrophy.
14983226 2004 Plasma MMP-2 and MMP-9 and their inhibitors TIMP-1 and TIMP-2 during human orthotopic liver transplantation. The effect of aprotinin and the relation to ischemia/reperfusion injury.
14973177 2004 MMP-2 and MMP-9 and their tissue inhibitors in the plasma of preterm and term neonates.
14962256 2004 Clinicopathological correlations of TIMP-1 and TIMP-2 in Hodgkin's lymphoma.
14744773 2004 Endometase/matrilysin-2 in human breast ductal carcinoma in situ and its inhibition by tissue inhibitors of metalloproteinases-2 and -4: a putative role in the initiation of breast cancer invasion.
14712492 2004 Frequent hypermethylation of 5' flanking region of TIMP-2 gene in cervical cancer.
14710472 2003 Different levels of TIMPs and MMPs in human lateral and medial rectus muscle tissue excised from strabismic patients.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14661256 2004 Matrix metalloproteinases MMP-2, -9 and tissue inhibitors TIMP-1, -2 expression and secretion by primary human osteoblast cells in response to titanium, zirconia, and alumina ceramics.
14654538 2003 Tissue inhibitor of metalloproteinase-2 as a multifunctional molecule of which the expression is associated with adverse prognosis of patients with urothelial bladder carcinomas.
14605322 2003 Tissue inhibitor of metalloproteinases-1, -2, and -3 polymorphisms in a white population with intracranial aneurysms.
14604886 2004 Substantial reduction in risk of breast cancer associated with genetic polymorphisms in the promoters of the matrix metalloproteinase-2 and tissue inhibitor of metalloproteinase-2 genes.
14598888 2003 The metalloproteinase inhibitor TIMP-2 is down-regulated by androgens in LNCaP prostate carcinoma cells.
14517716 2004 The contribution of familial resemblance to variation in circulatory levels of tissue inhibitors of metalloproteinases and transforming growth factor-beta1.
12970724 2003 Expression of matrix metalloproteinases (MMP-2 and -9) and their inhibitors (TIMP-1 and -2) in prostate cancer tissue.
12970394 2003 Increased expression of tissue inhibitor of metalloproteinase-2 in clear cell carcinoma of the ovary.
12900406 2003 Structural and functional uncoupling of the enzymatic and angiogenic inhibitory activities of tissue inhibitor of metalloproteinase-2 (TIMP-2): loop 6 is a novel angiogenesis inhibitor.
12887919 2003 TIMP-2 mediated inhibition of angiogenesis: an MMP-independent mechanism.
12614934 2003 Tissue inhibitors of matrix metalloproteinases are elevated in cerebrospinal fluid of neurodegenerative diseases.
12602913 2003 MMP-2 protein in invasive breast cancer and the impact of MMP-2/TIMP-2 phenotype on overall survival.
12479097 2002 [Expression of matrix metalloproteinase-2, 9 and their inhibitor-TIMP 1,2 in human squamous cell carcinoma of uterine cervix].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475252 2002 E. coli expression of TIMP-4 and comparative kinetic studies with TIMP-1 and TIMP-2: insights into the interactions of TIMPs and matrix metalloproteinase 2 (gelatinase A).
12470034 2002 Differential regulation of MMP-2, TIMP-2 and IL-6 in valve replacement versus CABG patients.
12446683 2003 The ERK/MAPK pathway regulates the activity of the human tissue factor pathway inhibitor-2 promoter.
12439941 2002 Expression of MMP-2,TIMP-2 protein and the ratio of MMP-2/TIMP-2 in gallbladder carcinoma and their significance.
12406369 2002 Tissue inhibitors of metalloproteinases 1 and 2 in human seminal plasma and their association with spermatozoa.
12374789 2002 Utilization of a novel recombinant myoglobin fusion protein expression system to characterize the tissue inhibitor of metalloproteinase (TIMP)-4 and TIMP-2 C-terminal domain and tails by mutagenesis. The importance of acidic residues in binding the MMP-2 hemopexin C-domain.
12372458 2002 Matrix metalloproteinase-2, membranous type 1 matrix metalloproteinase, and tissue inhibitor of metalloproteinase-2 expression in ectopic and eutopic endometrium.
12147251 2002 Both tissue inhibitors of metalloproteinases-1 (TIMP-1) and TIMP-2 activate Ras but through different pathways.
12034400 2002 A role for matrix metalloproteinases and tumor host interaction in hepatocellular carcinomas.
12032297 2002 Structural insight into the complex formation of latent matrix metalloproteinase 2 with tissue inhibitor of metalloproteinase 2.
11912288 2002 Reduced expression of tissue inhibitor of metalloproteinase (TIMP)-2 in gestational trophoblastic diseases.
11757622 2001 Tissue inhibitor of metalloproteinases-2 gene polymorphisms in chronic obstructive pulmonary disease.
11710594 2001 Human cervical tumor cell (SiHa) surface alphavbeta3 integrin receptor has associated matrix metalloproteinase (MMP-2) activity.
11606052 2001 Differential growth regulation in human melanoma cell lines by TIMP-1 and TIMP-2.
11598182 2001 Activation of matrix-metalloproteinase-2 and membrane-type-1-matrix-metalloproteinase in endothelial cells and induction of vascular permeability in vivo by human immunodeficiency virus-1 Tat protein and basic fibroblast growth factor.
11420387 2001 Matrix metalloproteinases and tissue inhibitors of metalloproteinases in human fetal testis and ovary.
11049985 2000 Platelet release of trimolecular complex components MT1-MMP/TIMP2/MMP2: involvement in MMP2 activation and platelet aggregation.
11004090 2000 Matrix metalloproteinases and their natural inhibitors in fibrovascular membranes of proliferative diabetic retinopathy.
10991943 2000 Domain interactions in the gelatinase A.TIMP-2.MT1-MMP activation complex. The ectodomain of the 44-kDa form of membrane type-1 matrix metalloproteinase does not modulate gelatinase A activation.
10764764 2000 NF-Y and Sp1 cooperate for the transcriptional activation and cAMP response of human tissue inhibitor of metalloproteinases-2.
10353844 1999 The N-terminus of collagenase MMP-8 determines superactivity and inhibition: a relation of structure and function analyzed by biomolecular interaction analysis.
9933646 1999 Identification of the tissue inhibitor of metalloproteinases-2 (TIMP-2) binding site on the hemopexin carboxyl domain of human gelatinase A by site-directed mutagenesis. The hierarchical role in binding TIMP-2 of the unique cationic clusters of hemopexin modules III and IV.
9837731 1998 Three-dimensional structure of human tissue inhibitor of metalloproteinases-2 at 2.1 A resolution.
9736043 1998 Differential expression and origin of membrane-type 1 and 2 matrix metalloproteinases (MT-MMPs) in association with MMP2 activation in injured human livers.
9705310 1998 High resolution structure of the N-terminal domain of tissue inhibitor of metalloproteinases-2 and characterization of its interaction site with matrix metalloproteinase-3.
9573338 1998 Cloning of three Caenorhabditis elegans genes potentially encoding novel matrix metalloproteinases.
9455735 1997 Serum levels of tissue inhibitor of metalloproteinases-2 and of precursor form of matrix metalloproteinase-2 in patients with liver disease.
9422789 1998 Tissue inhibitor of metalloproteinase-2 (TIMP-2) binds to the catalytic domain of the cell surface receptor, membrane type 1-matrix metalloproteinase 1 (MT1-MMP).
8985130 1996 mRNA expressions of TIMP-1, -2, and -3 and 92-KD type IV collagenase in early human placenta and decidual membrane as studied by in situ hybridization.
8810321 1996 Structure and characterization of the human tissue inhibitor of metalloproteinases-2 gene.
8757599 1996 HIV-1-Tat protein promotes chemotaxis and invasive behavior by monocytes.
8112602 1994 Characterization of the promoter of the gene encoding human tissue inhibitor of metalloproteinases-2 (TIMP-2).
7918391 1994 Solution structure of the active domain of tissue inhibitor of metalloproteinases-2. A new member of the OB fold protein family.
2793861 1989 Tissue inhibitor of metalloproteinase (TIMP-2). A new member of the metalloproteinase inhibitor family.
2554304 1989 Human 72-kilodalton type IV collagenase forms a complex with a tissue inhibitor of metalloproteases designated TIMP-2.
2380196 1990 Tissue inhibitor of metalloproteinases-2 (TIMP-2) mRNA expression in tumor cell lines and human tumor tissues.
2157214 1990 cDNA cloning and expression of a metalloproteinase inhibitor related to tissue inhibitor of metalloproteinases.
1869284 1991 Metastasis suppressor genes.
1730286 1992 Isolation and characterization of tissue inhibitors of metalloproteinases (TIMP-1 and TIMP-2) from human rheumatoid synovial fluid.
1655733 1991 Binding of tissue inhibitor of metalloproteinases 2 to two distinct sites on human 72-kDa gelatinase. Identification of a stabilization site.
1480041 1992 TIMP-2: identification and characterization of a new member of the metalloproteinase inhibitor family.
1427908 1992 The gene for tissue inhibitor of metalloproteinases-2 is localized on human chromosome arm 17q25.