Property Summary

NCBI Gene PubMed Count 211
Grant Count 478
R01 Count 274
Funding $68,267,127.1
PubMed Score 941.13
PubTator Score 667.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -3.164 0.000

Synonym

Accession P15976 Q96GB8
Symbols GF1
GF-1
NFE1
XLTT
ERYF1
NF-E1
XLANP
XLTDA
GATA-1

Gene

PANTHER Protein Class (2)

Gene RIF (182)

PMID Text
27052461 Concurrent exogenous expression of three transcription factors, GATA1, FLI1 and TAL1, enables large-scale production of megakaryocytes from human pluripotent stem cells.
27044088 study provides insight into GATA1 transcriptional activity and may prove a useful resource for investigating the pathogenicity of noncoding variants in human erythroid disorders.
27010793 The GATA-1-mediated inhibition of PU.1 gene transcription in human AML-erythroleukemias mediated through the URE represents important mechanism that contributes to PU.1 downregulation and leukemogenesis that is sensitive to DNA demethylation therapy
26766440 GATA2-to-GATA1 switch is prevalent at dynamic enhancers and drives erythroid enhancer commissioning
26713410 findings provide insights into the clinically relevant in vivo function of the N-terminal domain of GATA1 in human hematopoiesis.
26205501 Acute megakaryoblastic leukemia is associated with GATA-1 mutation, mimicking myeloproliferative disorders.
25755285 Results demonstrate that expression of the hGATA1 gene is regulated through the chromatin architecture organized by 5'CTCF site-mediated intrachromosomal interactions in the hGATA1 locus.
25726523 we uncovered a novel function of GATA1 in regulating Epithelial-mesenchymal transition
25682601 Global transcriptome and chromatin occupancy analysis reveal the short isoform of GATA1 is deficient for erythroid specification and gene expression.
25621499 Lineage-specific GATA1 cofactor associations are essential for normal chromatin occupancy.
More...

AA Sequence

MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYR      1 - 70
HSPVFQVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQAVEDLDGKGSTSFLETLKTER     71 - 140
LSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPCEARECVNCGAT    141 - 210
ATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCN    211 - 280
ACGLYYKLHQVNRPLTMRKDGIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVA    281 - 350
SGLTLGPPGTAHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS           351 - 413
//

Text Mined References (214)

PMID Year Title
27052461 2016 Large-scale production of megakaryocytes from human pluripotent stem cells by chemically defined forward programming.
27044088 2016 Insight into GATA1 transcriptional activity through interrogation of cis elements disrupted in human erythroid disorders.
27010793 2016 GATA-1 Inhibits PU.1 Gene via DNA and Histone H3K9 Methylation of Its Distal Enhancer in Erythroleukemia.
26766440 2016 Dynamic Control of Enhancer Repertoires Drives Lineage and Stage-Specific Transcription during Hematopoiesis.
26713410 2016 A Child With Dyserythropoietic Anemia and Megakaryocyte Dysplasia Due to a Novel 5'UTR GATA1s Splice Mutation.
26205501 Presentation of Acute Megakaryoblastic Leukemia Associated with a GATA-1 Mutation Mimicking the Eruption of Transient Myeloproliferative Disorder.
25755285 2015 The Human GATA1 Gene Retains a 5' Insulator That Maintains Chromosomal Architecture and GATA1 Expression Levels in Splenic Erythroblasts.
25726523 2015 GATA1 induces epithelial-mesenchymal transition in breast cancer cells through PAK5 oncogenic signaling.
25682601 2015 Global transcriptome and chromatin occupancy analysis reveal the short isoform of GATA1 is deficient for erythroid specification and gene expression.
25621499 2015 Pluripotent stem cells reveal erythroid-specific activities of the GATA1 N-terminus.
More...