Property Summary

NCBI Gene PubMed Count 10
Grant Count 3
R01 Count 3
Funding $104,256
PubMed Score 9.67
PubTator Score 2.99

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.622 0.000
astrocytoma -1.100 0.006
ovarian cancer -1.500 0.000

Synonym

Accession P15954 Q6NR81
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
25505242 The interaction of HIV-1 CA with human cellular cytochrome c oxidase subunit VIIc protein (COX7C) is identified by yeast two-hybrid screen
22419111 The interaction of HIV-1 CA with human cellular cytochrome c oxidase subunit VIIc protein (COX7C) is identified by yeast two-hybrid screen

AA Sequence

MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT             1 - 63
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
21269460 2011 Initial characterization of the human central proteome.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
17516841 2007 Mid-region parathyroid hormone-related protein (PTHrP) and gene expression of MDA-MB231 breast cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10072584 1998 Assignment of the human genes coding for cytochrome c oxidase subunits Va (COX5A), VIc (COX6C) and VIIc (COX7C) to chromosome bands 15q25, 8q22-->q23 and 5q14 and of three pseudogenes (COX5AP1, COX6CP1, COX7CP1) to 14q22, 16p12 and 13q14-->q21 by FISH and radiation hybrid mapping.
9752724 1998 Structural organization and transcription regulation of nuclear genes encoding the mammalian cytochrome c oxidase complex.
7926688 1994 Activation of blood clotting factors by microbial proteinases.
More...