Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.09
PubTator Score 2.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Obesity 678 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 6.8e-07
Multiple myeloma 1332 1.7e-05
astrocytoma 1146 6.4e-03

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytoma -1.100 6.4e-03
Multiple myeloma 1.622 1.7e-05
ovarian cancer -1.500 6.8e-07

Gene RIF (2)

AA Sequence

MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT             1 - 63
//

Text Mined References (12)

PMID Year Title