Property Summary

NCBI Gene PubMed Count 700
PubMed Score 3730.15
PubTator Score 2933.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Gastrointestinal system cancer 3 0.0 2.1

Expression

  Differential Expression (28)

Disease log2 FC p
active Crohn's disease 1.859 1.2e-02
active ulcerative colitis 1.660 1.2e-02
adult high grade glioma 1.400 4.0e-05
atypical teratoid / rhabdoid tumor 2.800 3.8e-07
breast carcinoma 1.900 9.7e-19
ductal carcinoma in situ 3.300 6.8e-04
Endometriosis -1.049 3.6e-02
ependymoma 1.700 1.8e-08
esophageal adenocarcinoma 1.800 2.1e-02
glioblastoma 1.500 2.7e-04
intraductal papillary-mucinous adenoma (... 1.200 1.7e-03
intraductal papillary-mucinous neoplasm ... 1.800 2.3e-03
invasive ductal carcinoma 2.600 1.6e-03
lung adenocarcinoma 1.310 2.5e-02
lung cancer -2.200 3.3e-03
lung carcinoma -3.900 2.1e-40
medulloblastoma, large-cell 1.400 8.2e-05
nasopharyngeal carcinoma -1.600 7.0e-10
non-small cell lung cancer -1.648 1.7e-06
osteosarcoma -1.343 1.2e-04
ovarian cancer 2.700 7.5e-08
pancreatic cancer 2.000 3.0e-04
pancreatic ductal adenocarcinoma liver m... 3.986 3.1e-03
pituitary cancer -1.400 1.1e-06
primary Sjogren syndrome -1.400 6.2e-03
psoriasis -1.200 1.7e-03
spina bifida -1.151 3.1e-02
urothelial carcinoma -1.300 4.9e-02

Gene RIF (646)

AA Sequence

MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGS      1 - 70
STTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTSAPDNKPAPGSTAPPAHGVTS     71 - 140
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS    141 - 210
TAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS    211 - 280
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS    281 - 350
TAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS    351 - 420
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS    421 - 490
TAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS    491 - 560
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS    561 - 630
TAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS    631 - 700
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS    701 - 770
TAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS    771 - 840
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS    841 - 910
TAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDNRPALGSTAPPVHNVTSASGSASGSASTLVHNGTSAR    911 - 980
ATTTPASKSTPFSIPSHHSDTPTTLASHSTKTDASSTHHSSVPPLTSSNHSTSPQLSTGVSFFFLSFHIS    981 - 1050
NLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQ   1051 - 1120
FNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKN   1121 - 1190
YGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL        1191 - 1255
//

Text Mined References (717)

PMID Year Title