Property Summary

NCBI Gene PubMed Count 640
Grant Count 600
R01 Count 281
Funding $104,439,605.91
PubMed Score 3531.95
PubTator Score 2933.59

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P15941 A5YRV1 A6ZID9 A6ZIE0 B1AVQ8 B1AVR0 B6ECA1 E7ESE5 E7EUG9 P13931 P15942 P17626 Q0VAP5 Q0VAP6 Q14128 Q14876 Q16437 Q16442 Q16615 Q6S4Y3 Q7Z547 Q7Z548 Q7Z550 Q7Z552 Q9BXA4 Q9UE75 Q9UE76 Q9UQL1 Q9Y4J2 MUC-1
Symbols EMA
MCD
PEM
PUM
KL-6
MAM6
MCKD
PEMT
CD227
H23AG
MCKD1
MUC-1
ADMCKD
ADMCKD1
CA 15-3
MUC-1/X
MUC1/ZD
MUC-1/SEC

Gene

PDB

1SM3   2ACM   2FO4  

Gene RIF (586)

PMID Text
27190429 Studies showed that MUC1 is a prognostic factor in gastric cancer, which acts as a marker of poor outcome in patients with gastric cancer.
27108412 MUC1 rs4072037 A/A genotype is associated with more severe pulmonary dysfunction and a higher rate of disease progression in PAP patients.
26838233 In saliva the correlation between autoantibodies anti-MUC1 and anti-HER2 more important than in serum.
26833129 MUC1 expression significantly correlated with that of MYC and its target genes in human KRAS mutant NSCLC tumors.
26731195 Data indicate the potential of functionalized Apt-carbon nanotubes conjugates for increasing the induction of apoptosis in Mucin-1 (MUC1) positive tumor cells by suppression of Bcl-xL transcript.
26667143 Our findings suggested that MUC1 plays an important role in CCL21-CCR7-induced lymphatic metastasis and may serve as a therapeutic target in esophageal squamous cell carcinoma .
26645913 These results indicate that in response to Pseudomonas aeruginosa or flagellin, EGFR associates with and tyrosine phosphorylates MUC1-CT in primary normal human bronchial epithelial cells, leading to increased MUC1-CT association with TLR5
26634497 There were differences in MUC1 and c-myc expression in benign and papillary thyroid carcinoma.
26617840 High level KL-6 in infected bronchoalveolar lavage fluid samples may reflect the injury of alveolar epithelium caused by M. pneumoniae.
26617744 silencing muc-1 reduced squamous cell carcinoma cellular colony forming ability, migration and invasion
More...

AA Sequence

MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGS      1 - 70
STTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTSAPDNKPAPGSTAPPAHGVTS     71 - 140
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS    141 - 210
TAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS    211 - 280
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS    281 - 350
TAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS    351 - 420
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS    421 - 490
TAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS    491 - 560
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS    561 - 630
TAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS    631 - 700
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS    701 - 770
TAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS    771 - 840
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS    841 - 910
TAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDNRPALGSTAPPVHNVTSASGSASGSASTLVHNGTSAR    911 - 980
ATTTPASKSTPFSIPSHHSDTPTTLASHSTKTDASSTHHSSVPPLTSSNHSTSPQLSTGVSFFFLSFHIS    981 - 1050
NLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQ   1051 - 1120
FNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKN   1121 - 1190
YGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL        1191 - 1255
//

Text Mined References (657)

PMID Year Title
27190429 2016 MUC1 Immunohistochemical Expression as a Prognostic Factor in Gastric Cancer: Meta-Analysis.
27108412 2016 MUC1 gene polymorphisms are associated with serum KL-6 levels and pulmonary dysfunction in pulmonary alveolar proteinosis.
26838233 2016 Usefulness of Salivary and Serum Auto-antibodies Against Tumor Biomarkers HER2 and MUC1 in Breast Cancer Screening.
26833129 2016 Inhibition of MUC1-C Suppresses MYC Expression and Attenuates Malignant Growth in KRAS Mutant Lung Adenocarcinomas.
26731195 2016 Preparation and evaluation of polyethylenimine-functionalized carbon nanotubes tagged with 5TR1 aptamer for targeted delivery of Bcl-xL shRNA into breast cancer cells.
26667143 2015 CCL21-CCR7 promotes the lymph node metastasis of esophageal squamous cell carcinoma by up-regulating MUC1.
26645913 2016 Pseudomonas aeruginosa stimulates tyrosine phosphorylation of and TLR5 association with the MUC1 cytoplasmic tail through EGFR activation.
26634497 2015 Characterization and significance of MUC1 and c-myc expression in elderly patients with papillary thyroid carcinoma.
26617840 2015 SP-D, KL-6, and HTI-56 levels in children with mycoplasma pneumoniae pneumonia.
26617744 2015 Muc-1 promotes migration and invasion of oral squamous cell carcinoma cells via PI3K-Akt signaling.
More...