Property Summary

NCBI Gene PubMed Count 90
Grant Count 20
R01 Count 10
Funding $1,668,815.31
PubMed Score 59.72
PubTator Score 102.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.073 0.014
diabetes mellitus -1.200 0.001
ovarian cancer 1.900 0.000

Gene RIF (37)

PMID Text
27068393 The authors show that Vpr can form a trimolecular complex with UNG2 and RPA32 and the positive effect of UNG2 and RPA32 on the reverse transcription process leading to optimal virus replication and dissemination between the primary target cells of HIV-1.
25113031 Expression of mutant RPA2 or loss of PALB2 expression led to significant DNA damage after replication stress, a defect accentuated by poly-ADP (adenosine diphosphate) ribose polymerase inhibitors.
24910198 Conserved motifs are required for RPA32 binding the the N-terminus of SMARCAL1.
24819595 RPA32 phosphorylation regulates replication arrest, recombination, late origin firing, and mitotic catastrophe
24730652 study reports the characterization of the RPA32C-SMARCAL1 interface at the molecular level; implications of results are discussed with respect to the recruitment of SMARCAL1 and other DNA damage response and repair proteins to stalled replication forks
23393223 study concludes RPA2 expression is translationally regulated via internal ribosome entry site and by eIF3a and that this regulation is partly accountable for cellular response to DNA damage and survival.
23047005 this study has explored the role of RPA32 phosphorylation at CDK and ATR sites and propose that phosphorylation of the RPA32 subunit is dispensable for checkpoint activation induced by replication stress with aphidicolin.
22684010 4E-BP3 regulates eIF4E-mediated nuclear mRNA export and interacts with replication protein A2
22521144 Data show that the R88C variant impairs binding of the R88C variant impairs binding of uracil-DNA glycosylase UNG2 to replication protein A RPA2.
22171270 Depletion of RPA2 by shRNA in HIV-1-producing 293T cells inhibits viral infectivity and replication
More...

AA Sequence

MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVE      1 - 70
ISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKS     71 - 140
LVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQN    141 - 210
QVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE              211 - 270
//

Text Mined References (105)

PMID Year Title
27068393 2016 Uracil DNA glycosylase interacts with the p32 subunit of the replication protein A complex to modulate HIV-1 reverse transcription for optimal virus dissemination.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25113031 2014 Phosphorylated RPA recruits PALB2 to stalled DNA replication forks to facilitate fork recovery.
24910198 2014 Structure of RPA32 bound to the N-terminus of SMARCAL1 redefines the binding interface between RPA32 and its interacting proteins.
24819595 2014 DNA-PK phosphorylation of RPA32 Ser4/Ser8 regulates replication stress checkpoint activation, fork restart, homologous recombination and mitotic catastrophe.
24730652 2014 Structural analysis of replication protein A recruitment of the DNA damage response protein SMARCAL1.
24332808 2014 PRP19 transforms into a sensor of RPA-ssDNA after DNA damage and drives ATR activation via a ubiquitin-mediated circuitry.
24126761 2013 hPrimpol1/CCDC111 is a human DNA primase-polymerase required for the maintenance of genome integrity.
23910567 2013 Cell cycle-dependent formation of Cdc45-Claspin complexes in human cells is compromized by UV-mediated DNA damage.
23393223 2013 Translational regulation of RPA2 via internal ribosomal entry site and by eIF3a.
More...