Property Summary

NCBI Gene PubMed Count 77
Grant Count 51
R01 Count 33
Funding $6,827,909.24
PubMed Score 255.23
PubTator Score 131.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 4.000 0.000
ependymoma 1.200 0.004
oligodendroglioma 1.300 0.007
osteosarcoma -2.135 0.003
group 4 medulloblastoma 2.200 0.001
astrocytoma 1.400 0.050
glioblastoma 1.400 0.021
periodontitis 1.700 0.000
medulloblastoma, large-cell 2.100 0.001
pancreatic ductal adenocarcinoma liver m... -3.105 0.006
lung cancer -2.200 0.000
interstitial cystitis 2.400 0.000
cystic fibrosis -1.800 0.000
pilocytic astrocytoma 1.500 0.000
primary Sjogren syndrome 1.900 0.001
acute myeloid leukemia -1.800 0.031
ovarian cancer 1.700 0.000
facioscapulohumeral dystrophy 2.200 0.000

Gene RIF (43)

PMID Text
26304831 Collectively, our data indicate that ST6GAL1 plays an important role in the regulation of pluripotency and differentiation in hPSCs.
26258617 Expression levels of sialyltransferases ST3GAL1 and ST3GAL4 were upregulated in the HRMECs after high-glucose stimulation.
26224120 Data indicate that O-glycan-specific alpha2,6 sialyltransferase regulate cancer growth and metastasis by regulating galectins Gal-1- and Gal-3-binding moieties on O-glycans.
26054692 These results suggest a role for ST6Gal-I to promote the growth and invasion of osteosarcoma cells.
25867765 CDX2 transcriptionally regulates ST6GalNAc-I gene expression, specifically in the preneoplastic intestinal metaplasia lesion.
25573487 Sialylation by beta-galactoside alpha-2,6-sialyltransferase regulates cell adhesion and invasion in human anaplastic large cell lymphoma.
25566667 The lymphocyte levels of NEU1 and ST6GAL1 mRNA expression are significantly increased in erythremia.
25465919 Study characterizes ST6GAL1 expression loss caused by aberrant ST6GAL1 promoter methylation potentially indicating a tumor suppressive role in bladder carcinogenesis.
25344606 ST6GAL1 promotes TGF-beta-dependent epithelial-mesenchymal transition
24606438 The study detected only one allele of each polymorphism in the ST6GAL1P1 promoter.
More...

AA Sequence

MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQD      1 - 70
PHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEAL     71 - 140
RCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLR    141 - 210
FNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNN    211 - 280
YKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKT    281 - 350
DVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC                  351 - 406
//

Text Mined References (80)

PMID Year Title
26304831 2015 Glycosyltransferase ST6GAL1 contributes to the regulation of pluripotency in human pluripotent stem cells.
26258617 2015 Alteration of N-Glycan Profiles in Diabetic Retinopathy.
26224120 2015 Galectin-Binding O-Glycosylations as Regulators of Malignancy.
26054692 2015 Knockdown of ST6Gal-I inhibits the growth and invasion of osteosarcoma MG-63 cells.
25867765 2015 CDX2 homeoprotein is involved in the regulation of ST6GalNAc-I gene in intestinal metaplasia.
25573487 2015 Sialylation by ?-galactoside ?-2,6-sialyltransferase and N-glycans regulate cell adhesion and invasion in human anaplastic large cell lymphoma.
25566667 2014 [Glycoprotein sialylation and NEU1 and ST6GAL1 expressions in erythremia].
25465919 2014 Epigenetic inactivation of ST6GAL1 in human bladder cancer.
25344606 2014 ?-Galactoside ?2,6-sialyltranferase 1 promotes transforming growth factor-?-mediated epithelial-mesenchymal transition.
24606438 2014 Promoter polymorphisms of ST3GAL4 and ST6GAL1 genes and associations with risk of premalignant and malignant lesions of the cervix.
More...