Property Summary

Ligand Count 5
NCBI Gene PubMed Count 88
PubMed Score 267.58
PubTator Score 131.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute myeloid leukemia -1.800 3.1e-02
astrocytoma 1.400 5.0e-02
Astrocytoma, Pilocytic 1.500 5.6e-07
cystic fibrosis -1.800 5.0e-04
ependymoma 1.200 4.2e-03
facioscapulohumeral dystrophy 2.200 1.8e-08
glioblastoma 1.400 2.1e-02
group 4 medulloblastoma 2.200 6.9e-04
interstitial cystitis 2.200 7.9e-04
lung cancer -2.200 1.0e-04
malignant mesothelioma 4.000 2.5e-08
medulloblastoma, large-cell 2.100 7.1e-04
oligodendroglioma 1.300 7.4e-03
osteosarcoma -2.135 2.9e-03
ovarian cancer 1.700 2.8e-04
pancreatic ductal adenocarcinoma liver m... -3.105 6.0e-03
periodontitis 1.700 1.1e-29
primary Sjogren syndrome 1.900 6.7e-04

Gene RIF (52)

AA Sequence

MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQD      1 - 70
PHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEAL     71 - 140
RCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLR    141 - 210
FNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNN    211 - 280
YKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKT    281 - 350
DVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC                  351 - 406
//

Text Mined References (91)

PMID Year Title