Property Summary

NCBI Gene PubMed Count 137
PubMed Score 281.47
PubTator Score 412.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
breast carcinoma 1614 1.10001342173102E-23
malignant mesothelioma 3163 1.94666090597354E-9
juvenile dermatomyositis 1189 4.1315531492215E-8
lung adenocarcinoma 2714 1.52906600604536E-7
Pick disease 1893 2.89072024992346E-7
ovarian cancer 8492 2.05268428995474E-6
Duchenne muscular dystrophy 602 3.47069650021897E-6
atypical teratoid / rhabdoid tumor 4369 3.73697050299951E-6
ulcerative colitis 2087 3.81875518221982E-6
osteosarcoma 7933 1.02211179825938E-5
nephrosclerosis 329 6.20640286031493E-5
psoriasis 6685 6.42459154375089E-5
chronic lymphocytic leukemia 244 6.80162476960396E-5
lung cancer 4473 1.05690641465214E-4
primary pancreatic ductal adenocarcinoma 1271 1.32752679125267E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 1.53043188888771E-4
pancreatic cancer 2300 3.4912958759665E-4
medulloblastoma, large-cell 6234 3.84368587423564E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.03262170286384E-4
interstitial cystitis 2299 4.35066211845542E-4
glioblastoma 5572 5.49416538589071E-4
acute quadriplegic myopathy 1157 6.23518001049574E-4
invasive ductal carcinoma 2950 7.05611682411724E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 9.83831346553709E-4
head and neck cancer 270 0.00133031295575658
oligodendroglioma 2849 0.00145303859111461
primary Sjogren syndrome 789 0.00275798635545246
group 4 medulloblastoma 1875 0.00636854289851784
ductal carcinoma in situ 1745 0.00786719612629623
pterygium 74 0.00934027576013635
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00983549155920061
pediatric high grade glioma 2712 0.010384646421865
Parkinson's disease 364 0.0116912762560558
primitive neuroectodermal tumor 3031 0.0151832074573355
dermatomyositis 967 0.0166712955298809
Rheumatoid Arthritis 1171 0.0180794725768938
gastric carcinoma 832 0.0213626897834128
Polycystic Ovary Syndrome 335 0.0224168201342138
astrocytic glioma 2241 0.0243586993178474
acute myeloid leukemia 785 0.0244099168151329
Disease Target Count Z-score Confidence
Intellectual disability 573 3.673 1.8
Epilepsy 346 0.0 4.0
Microcephaly 149 0.0 4.0
Disease Target Count Z-score Confidence
Cancer 2346 3.875 1.9

Expression

Synonym

Accession P15884 B3KT62 B3KUC0 B4DT37 B4DUG3 B7Z5M6 B7Z6Y1 G0LNT9 G0LNU0 G0LNU1 G0LNU2 G0LNU4 G0LNU5 G0LNU8 G0LNU9 G0LNV0 G0LNV1 G0LNV2 H3BPQ1 Q08AP2 Q08AP3 Q15439 Q15440 Q15441 TCF-4
Symbols E2-2
ITF2
PTHS
SEF2
FECD3
ITF-2
SEF-2
TCF-4
SEF2-1
SEF2-1A
SEF2-1B
SEF2-1D
bHLHb19

Gene

PDB

2KWF  

  Ortholog (12)

Gene RIF (91)

PMID Text
27014877 the beta-catenin/Tcf4 interaction is disrupted by BC-23
26884349 Studied promoter methylation of ITF2 and APC and associated microsatellite instability in two case-case studies nested in colorectal cancer.
26823848 The expression of NLK was negatively correlated with TCF4 expression in lung cancers
26622166 ZEB1 mutations and TCF4 rs613872 changes are associated with late onset Fuchs endothelial corneal dystrophy in patients from Northern India.
26451375 The data suggest that changes in the transcript level containing constitutive TCF4 exon encoding the amino-terminal part of the protein seem not to contribute to disease pathogenesis.
26401622 The TCF4 triplet repeat expansion resulted in a more severe form of Fuchs endothelial corneal dystrophy , with clinical and surgical therapeutic implications.
26387539 Results provides evidence that TCF4 and ZEB1 modulate each other's transcriptional activity in the regulation of tumor pro-invasive Wnt target genes.
26350900 The E3 ligase RNF43 inhibits Wnt signaling downstream of mutated beta-catenin by sequestering TCF4 to the nuclear membrane.
26343600 Results suggested that the TCF4 rs2958182 variant may play an important role in the susceptibility to schizophrenia
26218914 These findings show for the first time in a Japanese population the association of the TNR expansion in TCF4 with FECD.
More...

AA Sequence

MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNGGHPSPSRN      1 - 70
YGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLS     71 - 140
PTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSSKPATST    141 - 210
FPSSFFMQDGHHSSDPWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPM    211 - 280
STFHRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVG    281 - 350
SPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHG    351 - 420
IIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPP    421 - 490
QDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITSNNDDEDLTPEQKAE    491 - 560
REKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKA    561 - 630
ACLKRREEEKVSSEPPPLSLAGPHPGMGDASNHMGQM                                     631 - 667
//

Text Mined References (142)

PMID Year Title
27014877 2016 Enhancement of Radiation Sensitivity in Lung Cancer Cells by a Novel Small Molecule Inhibitor That Targets the ?-Catenin/Tcf4 Interaction.
26884349 2016 Promoter methylation of ITF2, but not APC, is associated with microsatellite instability in two populations of colorectal cancer patients.
26823848 2015 Expression of Nemo-like kinase was increased and negatively correlated with the expression of TCF4 in lung cancers.
26622166 2015 Association of ZEB1 and TCF4 rs613872 changes with late onset Fuchs endothelial corneal dystrophy in patients from northern India.
26451375 2015 Fuchs Endothelial Corneal Dystrophy: Strong Association with rs613872 Not Paralleled by Changes in Corneal Endothelial TCF4 mRNA Level.
26401622 2015 Correlation of Severity of Fuchs Endothelial Corneal Dystrophy With Triplet Repeat Expansion in TCF4.
26387539 2015 ZEB1 and TCF4 reciprocally modulate their transcriptional activities to regulate Wnt target gene expression.
26350900 2015 The E3 ligase RNF43 inhibits Wnt signaling downstream of mutated ?-catenin by sequestering TCF4 to the nuclear membrane.
26343600 2015 TCF4 gene polymorphism is associated with cognition in patients with schizophrenia and healthy controls.
26218914 2015 Trinucleotide Repeat Expansion in the TCF4 Gene in Fuchs' Endothelial Corneal Dystrophy in Japanese.
More...