Property Summary

NCBI Gene PubMed Count 137
Grant Count 220
R01 Count 126
Funding $19,693,782.27
PubMed Score 281.47
PubTator Score 412.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (57)

Disease Z-score Confidence
PITT-HOPKINS SYNDROME 21 6.913 3.5
Fuchs' endothelial dystrophy 20 4.746 2.4
Cancer 2,346 3.875 1.9
Schizophrenia 501 3.827 1.9
Intellectual disability 573 3.673 1.8
CORNEAL DYSTROPHY, FUCHS ENDOTHELIAL, 3 1
Chronic Lymphocytic Leukemia 242
Corneal disease 32 2.0
Craniofacial Abnormalities 147
Duchenne muscular dystrophy 602
Epilepsy 346 4.0
Gastrointestinal system disease 50 2.0
Heart Diseases 42
Liver neoplasms 109
Microcephaly 149 4.0
Parkinson's disease 364
Peripheral Neuropathy 303
Pick disease 1,893
Polycystic Ovary Syndrome 332
Primary sclerosing cholangitis 3
Retinal disease 16 1.0
Rheumatoid Arthritis 1,160
Seizures 95
acute myeloid leukemia 780
acute quadriplegic myopathy 1,157
astrocytic glioma 2,241
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
dermatomyositis 933
ductal carcinoma in situ 1,745
gastric carcinoma 832
glioblastoma 5,572
group 4 medulloblastoma 1,875
head and neck cancer 270
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung adenocarcinoma 2,713
lung cancer 4,466
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
nephrosclerosis 329
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
primary Sjogren syndrome 789
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
psoriasis 6,685
pterygium 74
ulcerative colitis 2,087

Expression

Synonym

Accession P15884 B3KT62 B3KUC0 B4DT37 B4DUG3 B7Z5M6 B7Z6Y1 G0LNT9 G0LNU0 G0LNU1 G0LNU2 G0LNU4 G0LNU5 G0LNU8 G0LNU9 G0LNV0 G0LNV1 G0LNV2 H3BPQ1 Q08AP2 Q08AP3 Q15439 Q15440 Q15441 TCF-4
Symbols E2-2
ITF2
PTHS
SEF2
FECD3
ITF-2
SEF-2
TCF-4
SEF2-1
SEF2-1A
SEF2-1B
SEF2-1D
bHLHb19

Gene

PDB

2KWF  

Gene RIF (91)

PMID Text
27014877 the beta-catenin/Tcf4 interaction is disrupted by BC-23
26884349 Studied promoter methylation of ITF2 and APC and associated microsatellite instability in two case-case studies nested in colorectal cancer.
26823848 The expression of NLK was negatively correlated with TCF4 expression in lung cancers
26622166 ZEB1 mutations and TCF4 rs613872 changes are associated with late onset Fuchs endothelial corneal dystrophy in patients from Northern India.
26451375 The data suggest that changes in the transcript level containing constitutive TCF4 exon encoding the amino-terminal part of the protein seem not to contribute to disease pathogenesis.
26401622 The TCF4 triplet repeat expansion resulted in a more severe form of Fuchs endothelial corneal dystrophy , with clinical and surgical therapeutic implications.
26387539 Results provides evidence that TCF4 and ZEB1 modulate each other's transcriptional activity in the regulation of tumor pro-invasive Wnt target genes.
26350900 The E3 ligase RNF43 inhibits Wnt signaling downstream of mutated beta-catenin by sequestering TCF4 to the nuclear membrane.
26343600 Results suggested that the TCF4 rs2958182 variant may play an important role in the susceptibility to schizophrenia
26218914 These findings show for the first time in a Japanese population the association of the TNR expansion in TCF4 with FECD.
More...

AA Sequence

MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNGGHPSPSRN      1 - 70
YGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLS     71 - 140
PTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSSKPATST    141 - 210
FPSSFFMQDGHHSSDPWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPM    211 - 280
STFHRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVG    281 - 350
SPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHG    351 - 420
IIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPP    421 - 490
QDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITSNNDDEDLTPEQKAE    491 - 560
REKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKA    561 - 630
ACLKRREEEKVSSEPPPLSLAGPHPGMGDASNHMGQM                                     631 - 667
//

Text Mined References (142)

PMID Year Title
27014877 2016 Enhancement of Radiation Sensitivity in Lung Cancer Cells by a Novel Small Molecule Inhibitor That Targets the ?-Catenin/Tcf4 Interaction.
26884349 2016 Promoter methylation of ITF2, but not APC, is associated with microsatellite instability in two populations of colorectal cancer patients.
26823848 2015 Expression of Nemo-like kinase was increased and negatively correlated with the expression of TCF4 in lung cancers.
26622166 2015 Association of ZEB1 and TCF4 rs613872 changes with late onset Fuchs endothelial corneal dystrophy in patients from northern India.
26451375 2015 Fuchs Endothelial Corneal Dystrophy: Strong Association with rs613872 Not Paralleled by Changes in Corneal Endothelial TCF4 mRNA Level.
26401622 2015 Correlation of Severity of Fuchs Endothelial Corneal Dystrophy With Triplet Repeat Expansion in TCF4.
26387539 2015 ZEB1 and TCF4 reciprocally modulate their transcriptional activities to regulate Wnt target gene expression.
26350900 2015 The E3 ligase RNF43 inhibits Wnt signaling downstream of mutated ?-catenin by sequestering TCF4 to the nuclear membrane.
26343600 2015 TCF4 gene polymorphism is associated with cognition in patients with schizophrenia and healthy controls.
26218914 2015 Trinucleotide Repeat Expansion in the TCF4 Gene in Fuchs' Endothelial Corneal Dystrophy in Japanese.
More...