Property Summary

NCBI Gene PubMed Count 34
PubMed Score 142.95
PubTator Score 226.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (12)

AA Sequence

MADDAGAAGGPGGPGGPGMGNRGGFRGGFGSGIRGRGRGRGRGRGRGRGARGGKAEDKEWMPVTKLGRLV      1 - 70
KDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLG     71 - 140
VKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVP    141 - 210
KKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRV    211 - 280
SVQRTQAPAVATT                                                             281 - 293
//

Text Mined References (49)

PMID Year Title