Property Summary

NCBI Gene PubMed Count 33
Grant Count 18
R01 Count 14
Funding $2,269,977.54
PubMed Score 138.16
PubTator Score 226.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (14)

PMID Text
26362536 HIV-1 Gag interacts with RPS2 as demonstrated by proximity dependent biotinylation proteomics
23166591 HIV-1 Gag interacts with RPS2 as demonstrated by proximity dependent biotinylation proteomics
23125841 HIV-1 Gag interacts with RPS2 as demonstrated by proximity dependent biotinylation proteomics
23125841 HIV-1 Gag interacts with RPS2 as demonstrated by proximity dependent biotinylation proteomics
23125841 HIV-1 Gag interacts with RPS2 as demonstrated by proximity dependent biotinylation proteomics
23125841 HIV-1 Gag interacts with RPS2 as demonstrated by proximity dependent biotinylation proteomics
22174317 HIV-1 Gag interacts with RPS2 as demonstrated by proximity dependent biotinylation proteomics
21584310 PAD4 citrullinates the Arg-Gly repeat region of RPS2, which is also an established site for Arg methylation by protein arginine methyltransferase 3 (PRMT3).
19138403 RPS2 or other aberrantly over-expressed ribosomal proteins might promote cancer and be excellent therapeutic targets for treatment of the disease
18573314 These results suggest that in addition to its catalytic function, PRMT3 may control the level of rpS2 protein in cells by inhibiting ubiquitin-mediated proteolysis of rpS2.
More...

AA Sequence

MADDAGAAGGPGGPGGPGMGNRGGFRGGFGSGIRGRGRGRGRGRGRGRGARGGKAEDKEWMPVTKLGRLV      1 - 70
KDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLG     71 - 140
VKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVP    141 - 210
KKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRV    211 - 280
SVQRTQAPAVATT                                                             281 - 293
//

Text Mined References (45)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...