Property Summary

NCBI Gene PubMed Count 31
Grant Count 32
R01 Count 24
Funding $3,602,939.87
PubMed Score 98.56
PubTator Score 48.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.200 0.000
ovarian cancer 1.200 0.000
facioscapulohumeral dystrophy 2.200 0.003

Gene RIF (15)

PMID Text
26642709 PAX1 methylation hallmarks a potential diagnostic value for cervical cancer screening in Asians
26552048 Hypermethylation of PAX1 gene may be highly associated with the development of cervical cancer.
26234429 meta-analysis support the utility of PAX1 methylation as an auxiliary biomarker in cervical cancer screening
25784220 analysis of a PAX1 enhancer locus that is associated with susceptibility to idiopathic scoliosis in females
24844223 PAX1 methylation is associated with cervical cancer.
24799352 PAX1 and SOX1 DNA methylation correlate with a cervical intraepithelial neoplasia diagnosis.
24568514 PAX1 methylation is associated with high-grade squamous intraepithelial lesions.
24407576 Cervical adenocarcinoma cells carry aberrantly high methylation rates of PAX1, commonly methylated in squamous cell carcinomas.
23907469 Testing PAX1 DNA methylation using oral swabs is a promising method for oral cancer detection. Combined assessments regarding betel nut consumption and DNA methylation can improve OSCC screening
23851939 We identified PAX1 as a novel disease-causing gene for otofaciocervical syndrome and show that the pooling of DNA from affected individuals can reduce the number of putative disease-causing homozygous variants in consanguineous families.
More...

AA Sequence

MKFTLGLGSRAWRVSWEGAAAAAAGPGAGGSALRCRAQRVSSPRLGRRGSRLSGALPLCLSRGGGGAQAL      1 - 70
PDCAGPSPGHPGHPGARQLAGPLAMEQTYGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQL     71 - 140
RVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPNVVKHIRDYKQGDPGIFAWEIRDRLLADGVCDKYN    141 - 210
VPSVSSISRILRNKIGSLAQPGPYEASKQPPSQPTLPYNHIYQYPYPSPVSPTGAKMGSHPGVPGTAGHV    211 - 280
SIPRSWPSAHSVSNILGIRTFMEQTGALAGSEGTAYSPKMEDWAGVNRTAFPATPAVNGLEKPALEADIK    281 - 350
YTQSASTLSAVGGFLPACAYPASNQHGVYSAPGGGYLAPGPPWPPAQGPPLAPPGAGVAVHGGELAAAMT    351 - 420
FKHPSREGSLPAPAARPRTPSVAYTDCPSRPRPPRGSSPRTRARRERQADPGAQVCAAAPAIGTGRIGGL    421 - 490
AEEEASAGPRGARPASPQAQPCLWPDPPHFLYWSGFLGFSELGF                              491 - 534
//

Text Mined References (33)

PMID Year Title
26642709 2015 PAX1 Methylation Hallmarks Promising Accuracy for Cervical Cancer Screening in Asians: Results from a Meta-Analysis.
26552048 2016 Methylation of Cervical Neoplastic Cells Infected With Human Papillomavirus 16.
26234429 2015 PAX1 methylation as an auxiliary biomarker for cervical cancer screening: a meta-analysis.
25784220 2015 A PAX1 enhancer locus is associated with susceptibility to idiopathic scoliosis in females.
24844223 2014 PAX1 methylation as a potential biomarker for cervical cancer screening.
24799352 2014 PAX1/SOX1 DNA methylation and cervical neoplasia detection: a Taiwanese Gynecologic Oncology Group (TGOG) study.
24568514 2014 PAX1 methylation analysis by MS-HRM is useful in triage of high-grade squamous intraepithelial lesions.
24407576 2014 High methylation rate of LMX1A, NKX6-1, PAX1, PTPRR, SOX1, and ZNF582 genes in cervical adenocarcinoma.
23907469 2014 DNA methylation of PAX1 as a biomarker for oral squamous cell carcinoma.
23851939 2013 A hypofunctional PAX1 mutation causes autosomal recessively inherited otofaciocervical syndrome.
More...