Property Summary

NCBI Gene PubMed Count 58
Grant Count 87
R01 Count 49
Funding $18,856,864.48
PubMed Score 280.14
PubTator Score 354.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Synonym

Accession P15848 B2RC20 Q8N322 Q9UDI9 ASB
Symbols ASB
G4S
MPS6

Gene

PANTHER Protein Class (1)

PDB

1FSU  

Gene RIF (30)

PMID Text
26609033 Nine novel mutations of ARSB were identified in MPS VI cases from India in the present study. The study also provides some insights into the genotype-phenotype association in MPS VI
25511584 Silencing Wnt9A increased the expression of CHST11 in the colonic epithelial cells, and chromatin immunoprecipitation assay demonstrated enhancing effects of Wnt9A siRNA and exogenous BMP4 on the CHST11 promoter
24778176 These studies reveal how carrageenan exposure can lead to transcriptional events in colonic epithelial cells through decline in arylsulfatase B activity, with subsequent impact on C4S, galectin-3, Sp1, and Wnt9A
24677745 Mutation analysis of the ARSB gene revealed seven missense and three frameshift mutations of which eight were novel.
24240681 Arylsulfatase B regulates versican expression by galectin-3 and AP-1 mediated transcriptional effects.
23855929 novel homozygous missense mutation, c.278 C>T, p.P93L, associated with mucopolysaccharidosis type VI
23835622 ARSB activity was significantly higher in the normal tissues.
23520469 results indicate that mammalian ARSB improves functional recovery after CNS injury.
23023219 Sequencing analysis revealed a novel homozygous missense mutation in the ARSB gene at c.1457A
22971959 PTC124 but not gentamicin, increases the level of ARSB activity.
More...

AA Sequence

MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTP      1 - 70
HLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTT     71 - 140
HMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMY    141 - 210
STNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNV    211 - 280
TAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHI    281 - 350
SDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLP    351 - 420
EYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSRE    421 - 490
YPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM                               491 - 533
//

Text Mined References (65)

PMID Year Title
26609033 2015 Novel mutations of the arylsulphatase B (ARSB) gene in Indian patients with mucopolysaccharidosis type VI.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25511584 2015 Regulation of chondroitin-4-sulfotransferase (CHST11) expression by opposing effects of arylsulfatase B on BMP4 and Wnt9A.
25343990 2015 Genome-wide association study of selenium concentrations.
24778176 2014 Increased expression of colonic Wnt9A through Sp1-mediated transcriptional effects involving arylsulfatase B, chondroitin 4-sulfate, and galectin-3.
24677745 2014 Clinical manifestations of 17 patients affected with mucopolysaccharidosis type VI and eight novel ARSB mutations.
24240681 2014 Arylsulfatase B regulates versican expression by galectin-3 and AP-1 mediated transcriptional effects.
23855929 2013 Case of a Mongolian child with extensive Mongolian spots in mucopolysaccharidosis type VI: identification of a novel mutation in the arylsulfatase B gene.
23835622 2013 Arylsulfatase B (N-acetylgalactosamine-4-sulfatase): potential role as a biomarker in prostate cancer.
23728934 2013 Polygenic transmission and complex neuro developmental network for attention deficit hyperactivity disorder: genome-wide association study of both common and rare variants.
More...