Property Summary

NCBI Gene PubMed Count 60
PubMed Score 314.54
PubTator Score 354.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Mucopolysaccharidosis VI 6 0.0 5.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Mucosulfatidosis 5 4.617 2.3
Disease Target Count
Mucopolysaccharidosis type VI 1

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 1.433 1.7e-02
group 4 medulloblastoma 1.100 4.0e-03
non primary Sjogren syndrome sicca -1.400 2.8e-02
ovarian cancer -1.200 2.6e-05
tuberculosis 1.100 9.1e-04

Gene RIF (32)

AA Sequence

MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTP      1 - 70
HLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTT     71 - 140
HMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMY    141 - 210
STNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNV    211 - 280
TAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHI    281 - 350
SDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLP    351 - 420
EYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSRE    421 - 490
YPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM                               491 - 533
//

Text Mined References (67)

PMID Year Title