Property Summary

NCBI Gene PubMed Count 30
PubMed Score 81.89
PubTator Score 159.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -4.944 7.6e-15

Synonym

Accession P15814 Q0P681
Symbols IGO
14.1
AGM2
IGL1
IGL5
IGLL
IGVPB
CD179b
VPREB2
IGLJ14.1

Gene

PDB

2H32   2H3N   2LKQ  

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (3)

AA Sequence

MRPGTGQGGLEAPGEPGPNLRQRWPLLLLGLAVVTHGLLRPTAASQSRALGPGAPGGSSRSSLRSRWGRF      1 - 70
LLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDF     71 - 140
YPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPA    141 - 210
ECS                                                                       211 - 213
//

Text Mined References (32)

PMID Year Title