Property Summary

NCBI Gene PubMed Count 28
Grant Count 3
R01 Count 3
Funding $18,507.78
PubMed Score 64.63
PubTator Score 159.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -4.944 0.000

Synonym

Accession P15814 Q0P681
Symbols IGO
14.1
AGM2
IGL1
IGL5
IGLL
IGVPB
CD179b
VPREB2
IGLJ14.1

Gene

PDB

2H32   2H3N   2LKQ  

Gene RIF (1)

PMID Text
23124203 Hhydrophobic residues from the lambda5-UR is crucial for the interaction with GAL1 and for pre-BCR clustering.

AA Sequence

MRPGTGQGGLEAPGEPGPNLRQRWPLLLLGLAVVTHGLLRPTAASQSRALGPGAPGGSSRSSLRSRWGRF      1 - 70
LLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDF     71 - 140
YPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPA    141 - 210
ECS                                                                       211 - 213
//

Text Mined References (30)

PMID Year Title
25009551 2014 The ATXN2-SH2B3 locus is associated with peripheral arterial disease: an electronic medical record-based genome-wide association study.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23124203 2012 Structural basis for galectin-1-dependent pre-B cell receptor (pre-BCR) activation.
21448238 2011 Meta-analysis of genome-wide association for migraine in six population-based European cohorts.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17431183 2007 Structural insight into pre-B cell receptor function.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16289162 2006 The identification of myocilin-associated proteins in the human trabecular meshwork.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...