Property Summary

NCBI Gene PubMed Count 32
Grant Count 11
R01 Count 6
Funding $446,316.31
PubMed Score 45.16
PubTator Score 169.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (22)

PMID Text
23677998 for isoforms CD1b through CD1e, our simulations show the near-complete collapse of the hydrophobic cavities in the absence of the antigen. This event results from the spontaneous closure of the binding domain entrance, flanked by two alpha-helices.
22880058 The interaction of LAPTM5 with CD1e and their colocalization in antigen processing compartments both suggest that LAPTM5 might influence the role of CD1e in the presentation of lipid antigens.
22782895 Deciphering the role of CD1e protein in mycobacterial phosphatidyl-myo-inositol mannosides (PIM) processing for presentation by CD1b to T lymphocytes
22003931 allelic variation in CD1E does not play a major role in determining multifocal motor neuropathy susceptibility.
21844346 CD1e may positively or negatively affect lipid presentation by CD1b, CD1c, and CD1d.
21788486 These data support that CD1e could have evolved to mediate lipid-exchange/editing processes.
21696499 In Guillain-Barre syndrome, an initially positive association study with polymorphism of CD1A and CD1E genes was not confirmed
21496400 CD1A and CD1E polymorphisms contribute to the polygenic susceptibility to multiple sclerosis
21481186 in the late endosomes/lysosomes of dendritic cells, the acid pH promotes the binding of lipid antigens to CD1e through increased hydrophobic and ionic interactions
20954848 CD1E and CD1A genes may be involved in networks which determine susceptibility to multiple sclerosis types RR-MS and PP-MS, respectively.
More...

AA Sequence

MLLLFLLFEGLCCPGENTAAPQALQSYHLAAEEQLSFRMLQTSSFANHSWAHSEGSGWLGDLQTHGWDTV      1 - 70
LGTIRFLKPWSHGNFSKQELKNLQSLFQLYFHSFIQIVQASAGQFQLEYPFEIQILAGCRMNAPQIFLNM     71 - 140
AYQGSDFLSFQGISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVK    141 - 210
PEAWLSCGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQRGTQRGDVLPNADETWYLRATLDVAAGEA    211 - 280
AGLSCRVKHSSLGGHDLIIHWGGYSIFLILICLTVIVTLVILVVVDSRLKKQSSNKNILSPHTPSPVFLM    281 - 350
GANTQDTKNSRHQFCLAQVSWIKNRVLKKWKTRLNQLW                                    351 - 388
//

Text Mined References (34)

PMID Year Title
23677998 2013 Dynamics of the antigen-binding grooves in CD1 proteins: reversible hydrophobic collapse in the lipid-free state.
22880058 2012 Lysosomal-associated transmembrane protein 5 (LAPTM5) is a molecular partner of CD1e.
22782895 2012 Deciphering the role of CD1e protein in mycobacterial phosphatidyl-myo-inositol mannosides (PIM) processing for presentation by CD1b to T lymphocytes.
22003931 2011 Multifocal motor neuropathy is not associated with genetic variation in PTPN22, BANK1, Blk, FCGR2B, CD1A/E, and TAG-1 genes.
21844346 2011 Fine tuning by human CD1e of lipid-specific immune responses.
21788486 2011 Crystal structure of human CD1e reveals a groove suited for lipid-exchange processes.
21696499 2011 Polymorphism of CD1 and SH2D2A genes in inflammatory neuropathies.
21496400 CD1A and CD1E gene polymorphisms are associated with susceptibility to multiple sclerosis.
21481186 2011 Increased flexibility and liposome-binding capacity of CD1e at endosomal pH.
20954848 2010 Association of CD1A +622 T/C, +737 G/C and CD1E +6129 A/G genes polymorphisms with multiple sclerosis.
More...