Property Summary

NCBI Gene PubMed Count 33
PubMed Score 48.36
PubTator Score 169.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 3.9e-03
ductal carcinoma in situ 1.600 3.0e-02
lung cancer -1.400 4.9e-04
non-small cell lung cancer and chronic o... -1.100 1.3e-02
primary Sjogren syndrome 1.700 1.2e-03
psoriasis -1.300 1.9e-05
tuberculosis 1.100 9.9e-03

Gene RIF (23)

AA Sequence

MLLLFLLFEGLCCPGENTAAPQALQSYHLAAEEQLSFRMLQTSSFANHSWAHSEGSGWLGDLQTHGWDTV      1 - 70
LGTIRFLKPWSHGNFSKQELKNLQSLFQLYFHSFIQIVQASAGQFQLEYPFEIQILAGCRMNAPQIFLNM     71 - 140
AYQGSDFLSFQGISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVK    141 - 210
PEAWLSCGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQRGTQRGDVLPNADETWYLRATLDVAAGEA    211 - 280
AGLSCRVKHSSLGGHDLIIHWGGYSIFLILICLTVIVTLVILVVVDSRLKKQSSNKNILSPHTPSPVFLM    281 - 350
GANTQDTKNSRHQFCLAQVSWIKNRVLKKWKTRLNQLW                                    351 - 388
//

Text Mined References (35)

PMID Year Title