Property Summary

Ligand Count 6
NCBI Gene PubMed Count 22
PubMed Score 9.87
PubTator Score 14.56

Knowledge Summary

Patent (3,208)

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma 1.300 7.2e-12
osteosarcoma -2.421 2.0e-10

Gene RIF (3)

AA Sequence

MTLDVGPEDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVTAERLSPEQLEEV      1 - 70
REATRRETHILRQVAGHPHIITLIDSYESSSFMFLVFDLMRKGELFDYLTEKVALSEKETRSIMRSLLEA     71 - 140
VSFLHANNIVHRDLKPENILLDDNMQIRLSDFGFSCHLEPGEKLRELCGTPGYLAPEILKCSMDETHPGY    141 - 210
GKEVDLWACGVILFTLLAGSPPFWHRRQILMLRMIMEGQYQFSSPEWDDRSSTVKDLISRLLQVDPEARL    211 - 280
TAEQALQHPFFERCEGSQPWNLTPRQRFRVAVWTVLAAGRVALSTHRVRPLTKNALLRDPYALRSVRHLI    281 - 350
DNCAFRLYGHWVKKGEQQNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG                  351 - 406
//

Text Mined References (27)

PMID Year Title