Property Summary

NCBI Gene PubMed Count 10
PubMed Score 34.55
PubTator Score 4.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.100 1.8e-06
astrocytic glioma 1.400 1.5e-02
ependymoma 2.100 2.2e-03
oligodendroglioma 1.900 5.8e-04
osteosarcoma -1.275 4.2e-05
atypical teratoid / rhabdoid tumor 1.100 6.3e-03
medulloblastoma, large-cell 1.500 5.5e-04
intraductal papillary-mucinous carcinoma... 1.100 7.7e-03
intraductal papillary-mucinous neoplasm ... 1.300 2.7e-03
lung cancer -1.200 1.6e-02
adult high grade glioma 1.100 1.1e-02
spina bifida -1.280 4.2e-02
Pick disease 1.200 1.4e-05
ovarian cancer -1.500 2.5e-07

AA Sequence

MALCYGTFWGYPKMLEAANLMEGLVDIGPWVTLPRGQPEVLEWGLPKDQDSVAFEDVAVNFTHEEWALLG      1 - 70
PSQKNLYRDVMRETIRNLNCIGMKWENQNIDDQHQNLRRNPRCDVVERFGKSKDGSQCGETLSQIRNSIV     71 - 140
NKNTPARVDACGSSVNGEVIMGHSSLNCYIRVDTGHKHRECHEYAEKSYTHKQCGKGLSYRHSFQTCERP    141 - 210
HTGKKPYDCKECGKTFSSPGNLRRHMVVKGGDGPYKCELCGKAFFWPSLLRMHERTHTGEKPYECKQCSK    211 - 280
AFPVYSSYLRHEKIHTGEKPYECKQCSKAFPDYSSYLRHERTHTGEKPYKCKQCGKAFSVSGSLRVHERI    281 - 350
HTGEKPYTCKQCGKAFCHLGSFQRHMIMHSGDGPHKCKICGKGFDFPGSARIHEGTHTLEKPYECKQCGK    351 - 420
LLSHRSSFRRHMMAHTGDGPHKCTVCGKAFDSPSVFQRHERTHTGEKPYECKQCGKAFRTSSSLRKHETT    421 - 490
HTGEQPYKCKCGKAFSDLFSFQSHETTHSEEEPYECKECGKAFSSFKYFCRHERTHSEEKSYECQICGKA    491 - 560
FSRFSYLKTHERTHTAEKPYECKQCRKAFFWPSFLLRHERTHTGERPYECKHCGKAFSRSSFCREHERTH    561 - 630
TGEKPYECKECGKAFSSLSSFNRHKRTHWKDIL                                         631 - 663
//

Text Mined References (13)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
2288909 1990 Multiple genes encoding zinc finger domains are expressed in human T cells.
1946370 1991 Characterization and mapping of human genes encoding zinc finger proteins.
1505991 1992 Clustering of C2-H2 zinc finger motif sequences within telomeric and fragile site regions of human chromosomes.