Property Summary

NCBI Gene PubMed Count 23
PubMed Score 478.40
PubTator Score 15.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Mucopolysaccharidosis III 7 0.0 5.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Mucopolysaccharidosis 26 5.004 2.5
Disease Target Count Z-score Confidence
Glomerulonephritis 46 4.087 2.0
Nephrotic Syndrome 78 3.588 1.8
Cancer 2499 3.004 1.5
Disease Target Count
Mucopolysaccharidosis, MPS-III-D 1

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy 1.301 7.9e-05
adrenocortical carcinoma 1.014 4.2e-02
adult high grade glioma 1.200 7.6e-04
astrocytoma 2.400 1.3e-02
Astrocytoma, Pilocytic 1.400 6.5e-08
atypical teratoid / rhabdoid tumor 1.700 1.7e-05
dermatomyositis 1.400 9.2e-04
diabetes mellitus -1.300 3.4e-03
ependymoma 1.300 2.2e-02
Gaucher disease type 1 -1.400 1.7e-02
glioblastoma 1.300 6.4e-07
group 4 medulloblastoma 1.400 2.7e-04
intraductal papillary-mucinous carcinoma... 1.100 4.3e-02
intraductal papillary-mucinous neoplasm ... 1.500 3.7e-02
juvenile dermatomyositis 1.002 1.6e-11
lung cancer -1.100 1.0e-02
medulloblastoma, large-cell 1.300 5.7e-06
osteosarcoma 2.733 3.1e-06
ovarian cancer -1.800 4.9e-09
Polycystic ovary syndrome -1.150 4.6e-03
primary pancreatic ductal adenocarcinoma 1.090 4.0e-02
psoriasis -1.200 1.6e-02
subependymal giant cell astrocytoma 2.307 1.9e-03

Protein-protein Interaction (6)

Gene RIF (7)

AA Sequence

MRLLPLAPGRLRRGSPRHLPSCSPALLLLVLGGCLGVFGVAAGTRRPNVVLLLTDDQDEVLGGMTPLKKT      1 - 70
KALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMC     71 - 140
GYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLAN    141 - 210
VSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNS    211 - 280
SIQFLDNAFRKRWQTLLSVDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKV    281 - 350
PLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEG    351 - 420
RNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITN    421 - 490
IAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHLL            491 - 552
//

Text Mined References (29)

PMID Year Title