Property Summary

NCBI Gene PubMed Count 507
PubMed Score 1326.41
PubTator Score 1307.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

Gene RIF (554)

AA Sequence

MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPA      1 - 70
ESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRS     71 - 140
KKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKK    141 - 210
RLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK          211 - 274
//

Text Mined References (515)

PMID Year Title