Property Summary

NCBI Gene PubMed Count 486
PubMed Score 1230.09
PubTator Score 1307.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 7.92973978913577E-15
pancreatic cancer 2300 1.09111841992972E-8
nasopharyngeal carcinoma 1056 5.67800453177173E-6
lung cancer 4473 7.7280086827911E-6
Breast cancer 3099 1.91958255790644E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.0912042875607E-4
group 4 medulloblastoma 1875 2.7764899595071E-4
lung adenocarcinoma 2714 3.98785947218303E-4
acute quadriplegic myopathy 1157 5.64501618979549E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.64990262828966E-4
medulloblastoma, large-cell 6234 8.48363764736921E-4
diabetes mellitus 1663 0.00338866036338143
head and neck cancer and chronic obstructive pulmonary disease 237 0.00343354442320145
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00346981537323857
psoriasis 6685 0.00759646871476001
subependymal giant cell astrocytoma 2287 0.00988322015367245
cutaneous lupus erythematosus 1056 0.0144691677340993
ovarian cancer 8492 0.0181274918166596
atypical teratoid/rhabdoid tumor 1095 0.0186032599625249
astrocytic glioma 2241 0.0357237973810025
invasive ductal carcinoma 2950 0.0363593468122153
pancreatic ductal adenocarcinoma liver metastasis 1795 0.03825020366149
Endometriosis 535 0.0441534249679602
Disease Target Count Z-score Confidence
Cancer 2346 5.162 2.6
Toxic encephalopathy 131 3.543 1.8
Atrophy of testis 5 3.106 1.6

Expression

Synonym

Accession P15559 B2R5Y9 B4DNM7 B7ZAD1 Q86UK1
Symbols DTD
QR1
DHQU
DIA4
NMOR1
NMORI

Gene

PDB

1D4A   1DXO   1GG5   1H66   1H69   1KBO   1KBQ   1QBG   2F1O   3JSX   4CET   4CF6   5A4K   5EA2   5EAI  

  Ortholog (10)

Gene RIF (534)

PMID Text
26723870 The present results demonstrate that exacerbated cisplatin-induced nephrotoxicity under the NQO1-knockout condition was accompanied by the reduced expression of MRN complex proteins, ATM, PARP1, and Sirt1.
26687450 NQO1 overexpression was a main determinant for a potential chemotherapy resistance or an increased sensitivity to quinone-bearing compounds.
26625776 The present study revealed that NQO1 CT, TT and CT+TT genotypes may be associated with clinical outcome and risk of developing NSCLC in the Indian population.
26600472 mercury increases oxidative stress (increased HO1 and NQO1 mRNA levels) and alters the cytoskeleton in the human endometrial Ishikawa cell line and to a lesser extent, in the "less-differentiated" human endometrial Hec-1b cells
26553038 Results show that NQO1 is up-regulated in non-small cell lung neoplasm which correlates with poor survival.
26459724 NQO1 was significantly increased in all of the diseased livers including peri-hepatocellular carcinoma tissues.
26452990 Flavin reductase and calreticulin play key roles in the development of pemetrexed-associated resistance in lung adenocarcinoma cells.
26257249 NQO1 gene polymorphisms influence stable warfarin doses in Korean patients
26078718 NQO1 Stabilizes p53 in Response to Oncogene-Induced Senescence.
26059226 HIV-1 Rev downregulates the expression of NQO1 which indirectly induces the degradation of Tat
More...

AA Sequence

MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPA      1 - 70
ESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRS     71 - 140
KKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKK    141 - 210
RLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK          211 - 274
//

Text Mined References (493)

PMID Year Title
26723870 2016 Deletion of NAD(P)H:quinone oxidoreductase 1 represses Mre11-Rad50-Nbs1 complex protein expression in cisplatin-induced nephrotoxicity.
26687450 2016 Overexpression of NAD(P)H:quinone oxidoreductase 1 (NQO1) and genomic gain of the NQO1 locus modulates breast cancer cell sensitivity to quinones.
26625776 2015 Clinical Significance of the NQO1 C609T Polymorphism in Non Small Cell Lung Adenocarcinoma Patients.
26600472 2015 Determination of Heavy Metal Concentrations in Normal and Pathological Human Endometrial Biopsies and In Vitro Regulation of Gene Expression by Metals in the Ishikawa and Hec-1b Endometrial Cell Line.
26553038 2016 Depleting Tumor-NQO1 Potentiates Anoikis and Inhibits Growth of NSCLC.
26459724 2015 Liver expression of Nrf2-related genes in different liver diseases.
26452990 2015 Identification of Up- and Down-Regulated Proteins in Pemetrexed-Resistant Human Lung Adenocarcinoma: Flavin Reductase and Calreticulin Play Key Roles in the Development of Pemetrexed-Associated Resistance.
26257249 2015 Effects of NAD(P)H quinone oxidoreductase 1 polymorphisms on stable warfarin doses in Korean patients with mechanical cardiac valves.
26078718 2015 NQO1 Stabilizes p53 in Response to Oncogene-Induced Senescence.
25933176 2015 Association of HMOX1 and NQO1 Polymorphisms with Metabolic Syndrome Components.
More...