Property Summary

NCBI Gene PubMed Count 250
Grant Count 105
R01 Count 75
Funding $10,177,997.95
PubMed Score 843.17
PubTator Score 880.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Synonym

Accession P15531 Q6FGK3 Q86XQ2 Q9UDJ6 NDK A
Symbols NB
AWD
NBS
GAAD
NDKA
NM23
NDPKA
NDPK-A
NM23-H1

Gene

PDB

1JXV   1UCN   2HVD   2HVE   3L7U   4ENO  

 OMIM Term (1)

Gene RIF (210)

PMID Text
26825905 NM23 expression is reduced in CRC tissues and low NM23 levels tightly correlate with higher Dukes stages, poorer differentiation grade, and positive lymph node metastases.
26634527 CRC patients with NM23-positive tumors had a better prognosis, and thus NM23 expression maybe used as a key prognostic indicator for CRC.
25808322 Fibronectin is an important effector of the motility-suppressing function of NME1 in melanoma cells.
25766862 HIV-1 RT forms a complex with NDPKA in vitro
25748386 Overexpression of Nm23H1 did not affect tumorigenesis in nude mice assays, while overexpression of Nm23H2 enhanced tumor growth with elevated expression of the c-Myc proto-oncogene.
25501107 nm23-H1 protein may be an important prognostic factor in peripheral T-cell lymphoma, not otherwise specified;the nm23-H1-positive group had significantly shorter overall survival (Review).
25373728 Using the described method for detecting histidine and aspartic acid phosphorylations and our prostate cancer progression cell system, the potential function of NM23-H1 in suppressing metastasis with a two-component regulation system is discussed
25321081 Nm23 loss could be associated with a more favorable environment for the development and dissemination of breast cancer
25277180 NM23-H1 may participate in head and neck squamous cell carcinoma cell responses to cisplatin and be considered a potential therapeutic target.
25199839 Regulation of the metastasis suppressor Nm23-H1 by tumor viruses
More...

AA Sequence

MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHS      1 - 70
GPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELV     71 - 140
DYTSCAQNWIYE                                                              141 - 152
//

Text Mined References (259)

PMID Year Title
26825905 2016 Reduced NM23 Protein Level Correlates With Worse Clinicopathologic Features in Colorectal Cancers: A Meta-Analysis of Pooled Data.
26634527 2015 Correlation between non-metastatic protein 23 expression and clinicopathological features of colorectal cancer in Asians.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25808322 2015 Metastasis suppressor NME1 regulates melanoma cell morphology, self-adhesion and motility via induction of fibronectin expression.
25748386 2015 Metastasis suppressors Nm23H1 and Nm23H2 differentially regulate neoplastic transformation and tumorigenesis.
25501107 2014 The association of nm23-H1 expression with a poor prognosis in patients with peripheral T-cell lymphoma, not otherwise specified.
25416956 2014 A proteome-scale map of the human interactome network.
25373728 2015 Evidence of histidine and aspartic acid phosphorylation in human prostate cancer cells.
25321081 2015 Loss of Nm23 is associated with a more favorable tumor microenvironment in patients with breast cancer.
25277180 2014 NM23-H1 expression of head and neck squamous cell carcinoma in association with the response to cisplatin treatment.
More...