Property Summary

NCBI Gene PubMed Count 266
PubMed Score 863.12
PubTator Score 880.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus -1.500 1.3e-02
lung adenocarcinoma 1.200 6.3e-15
non diabetic and post-ischemic heart fai... -1.200 1.1e-02
non-small cell lung carcinoma 1.400 3.8e-28

 OMIM Phenotype (1)

 GWAS Trait (1)

Gene RIF (224)

AA Sequence

MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHS      1 - 70
GPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELV     71 - 140
DYTSCAQNWIYE                                                              141 - 152
//

Text Mined References (275)

PMID Year Title